Cellulase (gene tox1) from Neurospora crassa
Enzyme Description
Sequence
MLIYVAEICLSVWLWDGLGDKKKGYAMLGWARPLILGCGSKNQ
Yue Xiao et al. (2016)
β Neurospora crassa tox-1 Gene Encodes a pH- and Temperature-Tolerant Mini-Cellulase
Journal of Agricultural and Food Chemistry
Β· doi:10.1021/acs.jafc.6b00043 β
Β· Stability - Incubation
▼
Database ID
UniProt: A0A0K2GUU6 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli DH5alpha
Experimental Data (6 measurements)
6 measurements
| Mutation | Property | Assay | Solvent | Solvent Volume | Aqueous Reference | WT Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| WT | Stability - Incubation | Activity after incubation (2 hours at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Methanol | 10 % v/v | 100.0 | β | 87.51 | % | Direct | Continuous | Incubation: 50 mM phosphate-buffered saline buffer, Assay: 50 mM phosphate-buffered saline buffer | Incubation: 7.4, Assay: 4 | Incubation: Room temperature, Assay: 50Β°C | 2.92 mM cellose | Reducing sugars | β | β | Non-incubated control (in %), assay measured in aqueous phase | Enzyme is a peptide |
| WT | Stability - Incubation | Activity after incubation (2 hours at room temperature), measured by absorbance spectrophotometry (DNS method, 540 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 10 % v/v | 100.0 | β | 96.78 | % | Direct | Continuous | Incubation: 50 mM phosphate-buffered saline buffer, Assay: 50 mM phosphate-buffered saline buffer | Incubation: 7.4, Assay: 4 | Incubation: Room temperature, Assay: 50Β°C | 2.92 mM cellose | Reducing sugars | β | β | Non-incubated control (in %), assay measured in aqueous phase | Enzyme is a peptide |
| Y4L/C9L | Stability - Incubation | Activity after incubation (2 hours at room temperature), measured by absorbance spectrophotometry (DNS method, 540 nm) in aqueous phase | Methanol | 10 % v/v | 100.0 | 87.51 | 97.56 | % | Direct | Continuous | Incubation: 50 mM phosphate-buffered saline buffer, Assay: 50 mM phosphate-buffered saline buffer | Incubation: 7.4, Assay: 4 | Incubation: Room temperature, Assay: 50Β°C | 2.92 mM cellose | Reducing sugars | β | β | Non-incubated control (in %), assay measured in aqueous phase | Enzyme is a peptide |
| Y4L/C9L | Stability - Incubation | Activity after incubation (2 hours at room temperature), measured by absorbance spectrophotometry (DNS method, 540 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 10 % v/v | 100.0 | 96.78 | 113.04 | % | Direct | Continuous | Incubation: 50 mM phosphate-buffered saline buffer, Assay: 50 mM phosphate-buffered saline buffer | Incubation: 7.4, Assay: 4 | Incubation: Room temperature, Assay: 50Β°C | 2.92 mM cellose | Reducing sugars | β | β | Non-incubated control (in %), assay measured in aqueous phase | Enzyme is a peptide |
| Y4L/A6L/C9L | Stability - Incubation | Activity after incubation (2 hours at room temperature), measured by absorbance spectrophotometry (DNS method, 540 nm) in aqueous phase | Methanol | 10 % v/v | 100.0 | 87.51 | 98.81 | % | Direct | Continuous | Incubation: 50 mM phosphate-buffered saline buffer, Assay: 50 mM phosphate-buffered saline buffer | Incubation: 7.4, Assay: 4 | Incubation: Room temperature, Assay: 50Β°C | 2.92 mM cellose | Reducing sugars | β | β | Non-incubated control (in %), assay measured in aqueous phase | Enzyme is a peptide |
| Y4L/A6L/C9L | Stability - Incubation | Activity after incubation (2 hours at room temperature), measured by absorbance spectrophotometry (DNS method, 540 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 10 % v/v | 100.0 | 96.78 | 94.94 | % | Direct | Continuous | Incubation: 50 mM phosphate-buffered saline buffer, Assay: 50 mM phosphate-buffered saline buffer | Incubation: 7.4, Assay: 4 | Incubation: Room temperature, Assay: 50Β°C | 2.92 mM cellose | Reducing sugars | β | β | Non-incubated control (in %), assay measured in aqueous phase | Enzyme is a peptide |
Mutations in this dataset (3)
WT
Y4L/A6L/C9L
Y4L/C9L
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume. β β β Reference value. Hover for details.
Mutation Effect
Mutation impact on enzyme stability and function in the presence of organic solvent: comparison of wild-type and mutant values in identical conditions.