Esterase (gene PmEst) from Petrotoga mobilis
Enzyme Description
Sequence
MALLEVNFMSRSLMRKVPIMVVLPMDKANLSGKSEITDNDNNTFKTLYLLHGIFGNYSDWVSETRIQRLAEGRNLAVVMPSGENSFYLDQPESGNFYGEFIGRELVNITRKMFPLSRKKEDTFIAGLSMGGYGAIRNGLKYHETFGCVAGLSSALNFEQMLDESYQVIACKKSAFGDPKEAILSDKNPKVLVKNIKENPLGQFPKMYMACGTEDNLINSNRDFRDFLIENNVDLTYEEGPGAHTWEFWDTYIEKVLDWLPLKKPS
Jose L. S. Lopes et al. (2016)
β Environmental Factors Modulating the Stability and Enzymatic Activity of the Petrotoga mobilis Esterase (PmEst)
▼
Database ID
UniProt: A9BJT6 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli Rosetta (DE3)
Experimental Data (10 measurements)
10 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethanol | 10 % v/v | 100.0 | 84.0 | % | Digital | Continuous | 10 mM sodium phosphate buffer | 7.4 | 25Β°C and 55Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethanol | 20 % v/v | 100.0 | 60.0 | % | Digital | Continuous | 10 mM sodium phosphate buffer | 7.4 | 25Β°C and 55Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethanol | 30 % v/v | 100.0 | 24.0 | % | Digital | Continuous | 10 mM sodium phosphate buffer | 7.4 | 25Β°C and 55Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | 1-Propanol | 10 % v/v | 100.0 | 87.0 | % | Digital | Continuous | 10 mM sodium phosphate buffer | 7.4 | 25Β°C and 55Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | 1-Propanol | 20 % v/v | 100.0 | 50.0 | % | Digital | Continuous | 10 mM sodium phosphate buffer | 7.4 | 25Β°C and 55Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | 1-Propanol | 30 % v/v | 100.0 | 11.0 | % | Digital | Continuous | 10 mM sodium phosphate buffer | 7.4 | 25Β°C and 55Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Stability - Tm | Melting temperature measured by circular dichroism in the presence of organic solvent | Ethanol | 20 % v/v | 42.8 | 47.3 | Β°C | Digital | Continuous | 10 mM sodium phosphate buffer | 7.4 | β | β | β | β | β | Classical aqueous control (in Β°C) |
| Stability - Tm | Melting temperature measured by circular dichroism in the presence of organic solvent | 1-Propanol | 20 % v/v | 42.8 | 48.4 | Β°C | Digital | Continuous | 10 mM sodium phosphate buffer | 7.4 | β | β | β | β | β | Classical aqueous control (in Β°C) |
| Stability - Tm | Melting temperature measured by circular dichroism in the presence of organic solvent | 1-Propanol | 10 % v/v | 42.8 | 50.4 | Β°C | Digital | Continuous | 10 mM sodium phosphate buffer | 7.4 | β | β | β | β | β | Classical aqueous control (in Β°C) |
| Stability - Tm | Melting temperature measured by circular dichroism in the presence of organic solvent | Ethanol | 10 % v/v | 42.8 | 50.8 | Β°C | Digital | Continuous | 10 mM sodium phosphate buffer | 7.4 | β | β | β | β | β | Classical aqueous control (in Β°C) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.
Visualization : Stability β Tm
One bar per measurement. Colour = solvent, shade = solvent volume.