Esterase (gene PmEst) from Petrotoga mobilis

Enzyme Description

Extremophile
Yes "thermophilic" organism
EC Number

Sequence

Length: 265 amino acids
MALLEVNFMSRSLMRKVPIMVVLPMDKANLSGKSEITDNDNNTFKTLYLLHGIFGNYSDWVSETRIQRLAEGRNLAVVMPSGENSFYLDQPESGNFYGEFIGRELVNITRKMFPLSRKKEDTFIAGLSMGGYGAIRNGLKYHETFGCVAGLSSALNFEQMLDESYQVIACKKSAFGDPKEAILSDKNPKVLVKNIKENPLGQFPKMYMACGTEDNLINSNRDFRDFLIENNVDLTYEEGPGAHTWEFWDTYIEKVLDWLPLKKPS
Jose L. S. Lopes et al. (2016) β€” Environmental Factors Modulating the Stability and Enzymatic Activity of the Petrotoga mobilis Esterase (PmEst)
PLOS ONE  Β· doi:10.1371/journal.pone.0158146 β†—  Β· Activity - Classical Stability - Tm
10 measurements
Database ID
UniProt: A9BJT6 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli Rosetta (DE3)

Experimental Data (10 measurements)

10 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 10 % v/v 100.0 84.0 % Digital Continuous 10 mM sodium phosphate buffer 7.4 25Β°C and 55Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 20 % v/v 100.0 60.0 % Digital Continuous 10 mM sodium phosphate buffer 7.4 25Β°C and 55Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 30 % v/v 100.0 24.0 % Digital Continuous 10 mM sodium phosphate buffer 7.4 25Β°C and 55Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent 1-Propanol 10 % v/v 100.0 87.0 % Digital Continuous 10 mM sodium phosphate buffer 7.4 25Β°C and 55Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent 1-Propanol 20 % v/v 100.0 50.0 % Digital Continuous 10 mM sodium phosphate buffer 7.4 25Β°C and 55Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent 1-Propanol 30 % v/v 100.0 11.0 % Digital Continuous 10 mM sodium phosphate buffer 7.4 25Β°C and 55Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Classical aqueous control (in %)
Stability - Tm Melting temperature measured by circular dichroism in the presence of organic solvent Ethanol 20 % v/v 42.8 47.3 Β°C Digital Continuous 10 mM sodium phosphate buffer 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by circular dichroism in the presence of organic solvent 1-Propanol 20 % v/v 42.8 48.4 Β°C Digital Continuous 10 mM sodium phosphate buffer 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by circular dichroism in the presence of organic solvent 1-Propanol 10 % v/v 42.8 50.4 Β°C Digital Continuous 10 mM sodium phosphate buffer 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by circular dichroism in the presence of organic solvent Ethanol 10 % v/v 42.8 50.8 Β°C Digital Continuous 10 mM sodium phosphate buffer 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Tm

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*