Serine protease from Trichoderma koningii
Enzyme Description
Sequence
MRLSVLLSVLPLVLVAPATEKRAEPAPLLVPTTKHGLVADKYIVKFKDGSSLQAVDEAISGLVSNADHVYQHVFRGFAATLDKKTLETLRNHPEVDYIEQDAVVKINSYVSQSGAPWGLGRISHKARGSTTYVYDDSAGAGTCSYVIDTGVDAAHPDFEGRATLLRSFVSGQNTDGNGHGTHVSGTIGSRTYGVAKKTQIYGIKVLDNSGSGSFSTVIAGMDYVASDSQTRNCPNGSVANMSLGGGYTASVNQAAARLIQAGVFLAVAAGNDGVDARNTSPASEPSVCTVGASTSSDARASFSNYGSVVDIFAPGQDILSTWPNRQTNAISGTSMATPHIVGLGAYLAGLEGFSDPQALCARIQALAGRNLLSGIPSGTINAIAFNGNPSG
Min Shu et al. (2016)
β High-level expression and characterization of a novel serine protease in Pichia pastoris by multi-copy integration
Enzyme and Microbial Technology
Β· doi:10.1016/j.enzmictec.2016.06.007 β
Β· Stability - Incubation
▼
Database ID
UniProt: A2TM20 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host yeast Pichia pastoris GS115
Experimental Data (18 measurements)
18 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase | Isopropanol | 10 % v/v | 100 | 100 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 55Β°C | 0.5% (w/v) Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase | Glycerol | 10 % v/v | 100 | 106 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 55Β°C | 0.5% (w/v) Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase | Glycerol | 5 % v/v | 100 | 102 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 55Β°C | 0.5% (w/v) Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase | Acetonitrile | 10 % v/v | 100 | 96 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 55Β°C | 0.5% (w/v) Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase | Acetonitrile | 5 % v/v | 100 | 100 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 55Β°C | 0.5% (w/v) Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase | Acetone | 10 % v/v | 100 | 3 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 55Β°C | 0.5% (w/v) Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase | Acetone | 5 % v/v | 100 | 46 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 55Β°C | 0.5% (w/v) Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase | 1-Butanol | 10 % v/v | 100 | 47 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 55Β°C | 0.5% (w/v) Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase | 1-Butanol | 5 % v/v | 100 | 72 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 55Β°C | 0.5% (w/v) Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase | Methanol | 5 % v/v | 100 | 103 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 55Β°C | 0.5% (w/v) Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase | Isopropanol | 5 % v/v | 100 | 101 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 55Β°C | 0.5% (w/v) Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase | 1-Propanol | 10 % v/v | 100 | 87 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 55Β°C | 0.5% (w/v) Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase | 1-Propanol | 5 % v/v | 100 | 96 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 55Β°C | 0.5% (w/v) Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase | Ethylene Glycol | 10 % v/v | 100 | 106 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 55Β°C | 0.5% (w/v) Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase | Ethylene Glycol | 5 % v/v | 100 | 103 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 55Β°C | 0.5% (w/v) Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase | Ethanol | 10 % v/v | 100 | 109 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 55Β°C | 0.5% (w/v) Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase | Ethanol | 5 % v/v | 100 | 103 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 55Β°C | 0.5% (w/v) Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (60 minutes at 37Β°C), measured by absorbance spectrophotometry (free tyrosine absorbance measurement, 275 nm) in aqueous phase | Methanol | 10 % v/v | 100 | 104 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 55Β°C | 0.5% (w/v) Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.