Laccase (gene LaclK) from Kurthia huakuii LAM0618T
Enzyme Description
Species
Extremophile
Yes
"thermophilic" organism, "organic-solvent tolerant" enzyme
EC Number
Sequence
MTTTIYTNNEQVLMGISLQDDTRPEKNNMALHVCENPETIIQNREHLAASIGHSLQDFVCANQTHSATYYKVTAADKGRGTLRADDAIPATDALYTFEPNIVLSSFTADCVPVLFYATDSTLIGAIHSGWQGTVKEISLKTFTHLKEHEHVDLTNVRVQIGTALSQEKFEVDEDVYTKFKTLGYANDWMYFKDATQKYHIDNQQTVKKQCELAGIPAENITIENVCTFKSDSGFSYRQHKQAGRHLSFIVRK
Xiang Guo et al. (2016)
β Characterization of a Highly Thermostable and Organic Solvent-Tolerant Copper-Containing Polyphenol Oxidase with Dye-Decolorizing Ability from Kurthia huakuii LAM0618T
PLOS ONE
Β· doi:10.1371/journal.pone.0164810 β
Β· Activity + Stability - Incubation
▼
Database ID
UniParc: UPI000494E4CE β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (15 measurements)
15 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (produced quinone absorbance measurement, 468 nm) in the presence of organic solvent | Methanol | 10 % v/v | 100.0 | 102.14 | % | Direct | Continuous | Incubation: 50 mM phosphate buffe, Assay: 50 mM phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 4Β°C, Assay: 65Β°C | 2 mM 2,6-Dimethoxyphenol | 2,6-dimethoxy-1,4-benzoquinone | 0.2 mM CuΒ²βΊ | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (produced quinone absorbance measurement, 468 nm) in the presence of organic solvent | Methanol | 20 % v/v | 100.0 | 94.8 | % | Direct | Continuous | Incubation: 50 mM phosphate buffe, Assay: 50 mM phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 4Β°C, Assay: 65Β°C | 2 mM 2,6-Dimethoxyphenol | 2,6-dimethoxy-1,4-benzoquinone | 0.2 mM CuΒ²βΊ | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (produced quinone absorbance measurement, 468 nm) in the presence of organic solvent | Methanol | 30 % v/v | 100.0 | 91.57 | % | Direct | Continuous | Incubation: 50 mM phosphate buffe, Assay: 50 mM phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 4Β°C, Assay: 65Β°C | 2 mM 2,6-Dimethoxyphenol | 2,6-dimethoxy-1,4-benzoquinone | 0.2 mM CuΒ²βΊ | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (produced quinone absorbance measurement, 468 nm) in the presence of organic solvent | Ethanol | 10 % v/v | 100.0 | 125.39 | % | Direct | Continuous | Incubation: 50 mM phosphate buffe, Assay: 50 mM phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 4Β°C, Assay: 65Β°C | 2 mM 2,6-Dimethoxyphenol | 2,6-dimethoxy-1,4-benzoquinone | 0.2 mM CuΒ²βΊ | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (produced quinone absorbance measurement, 468 nm) in the presence of organic solvent | Ethanol | 20 % v/v | 100.0 | 90.79 | % | Direct | Continuous | Incubation: 50 mM phosphate buffe, Assay: 50 mM phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 4Β°C, Assay: 65Β°C | 2 mM 2,6-Dimethoxyphenol | 2,6-dimethoxy-1,4-benzoquinone | 0.2 mM CuΒ²βΊ | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (produced quinone absorbance measurement, 468 nm) in the presence of organic solvent | Ethanol | 30 % v/v | 100.0 | 57.83 | % | Direct | Continuous | Incubation: 50 mM phosphate buffe, Assay: 50 mM phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 4Β°C, Assay: 65Β°C | 2 mM 2,6-Dimethoxyphenol | 2,6-dimethoxy-1,4-benzoquinone | 0.2 mM CuΒ²βΊ | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (produced quinone absorbance measurement, 468 nm) in the presence of organic solvent | Isopropanol | 10 % v/v | 100.0 | 137.16 | % | Direct | Continuous | Incubation: 50 mM phosphate buffe, Assay: 50 mM phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 4Β°C, Assay: 65Β°C | 2 mM 2,6-Dimethoxyphenol | 2,6-dimethoxy-1,4-benzoquinone | 0.2 mM CuΒ²βΊ | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (produced quinone absorbance measurement, 468 nm) in the presence of organic solvent | Isopropanol | 20 % v/v | 100.0 | 94.21 | % | Direct | Continuous | Incubation: 50 mM phosphate buffe, Assay: 50 mM phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 4Β°C, Assay: 65Β°C | 2 mM 2,6-Dimethoxyphenol | 2,6-dimethoxy-1,4-benzoquinone | 0.2 mM CuΒ²βΊ | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (produced quinone absorbance measurement, 468 nm) in the presence of organic solvent | Isopropanol | 30 % v/v | 100.0 | 41.59 | % | Direct | Continuous | Incubation: 50 mM phosphate buffe, Assay: 50 mM phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 4Β°C, Assay: 65Β°C | 2 mM 2,6-Dimethoxyphenol | 2,6-dimethoxy-1,4-benzoquinone | 0.2 mM CuΒ²βΊ | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (produced quinone absorbance measurement, 468 nm) in the presence of organic solvent | 1-Butanol | 10 % v/v | 100.0 | 112.91 | % | Direct | Continuous | Incubation: 50 mM phosphate buffe, Assay: 50 mM phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 4Β°C, Assay: 65Β°C | 2 mM 2,6-Dimethoxyphenol | 2,6-dimethoxy-1,4-benzoquinone | 0.2 mM CuΒ²βΊ | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (produced quinone absorbance measurement, 468 nm) in the presence of organic solvent | 1-Butanol | 20 % v/v | 100.0 | 132.3 | % | Direct | Continuous | Incubation: 50 mM phosphate buffe, Assay: 50 mM phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 4Β°C, Assay: 65Β°C | 2 mM 2,6-Dimethoxyphenol | 2,6-dimethoxy-1,4-benzoquinone | 0.2 mM CuΒ²βΊ | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (produced quinone absorbance measurement, 468 nm) in the presence of organic solvent | 1-Butanol | 30 % v/v | 100.0 | 124.17 | % | Direct | Continuous | Incubation: 50 mM phosphate buffe, Assay: 50 mM phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 4Β°C, Assay: 65Β°C | 2 mM 2,6-Dimethoxyphenol | 2,6-dimethoxy-1,4-benzoquinone | 0.2 mM CuΒ²βΊ | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (produced quinone absorbance measurement, 468 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 10 % v/v | 100.0 | 153.23 | % | Direct | Continuous | Incubation: 50 mM phosphate buffe, Assay: 50 mM phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 4Β°C, Assay: 65Β°C | 2 mM 2,6-Dimethoxyphenol | 2,6-dimethoxy-1,4-benzoquinone | 0.2 mM CuΒ²βΊ | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (produced quinone absorbance measurement, 468 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 20 % v/v | 100.0 | 31.35 | % | Direct | Continuous | Incubation: 50 mM phosphate buffe, Assay: 50 mM phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 4Β°C, Assay: 65Β°C | 2 mM 2,6-Dimethoxyphenol | 2,6-dimethoxy-1,4-benzoquinone | 0.2 mM CuΒ²βΊ | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Activity + Stability - Incubation | Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (produced quinone absorbance measurement, 468 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 30 % v/v | 100.0 | 22.95 | % | Direct | Continuous | Incubation: 50 mM phosphate buffe, Assay: 50 mM phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 4Β°C, Assay: 65Β°C | 2 mM 2,6-Dimethoxyphenol | 2,6-dimethoxy-1,4-benzoquinone | 0.2 mM CuΒ²βΊ | β | Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
Visualization : Activity + Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.