Laccase (gene LaclK) from Kurthia huakuii LAM0618T

Enzyme Description

Extremophile
Yes "thermophilic" organism, "organic-solvent tolerant" enzyme
EC Number

Sequence

Length: 252 amino acids
MTTTIYTNNEQVLMGISLQDDTRPEKNNMALHVCENPETIIQNREHLAASIGHSLQDFVCANQTHSATYYKVTAADKGRGTLRADDAIPATDALYTFEPNIVLSSFTADCVPVLFYATDSTLIGAIHSGWQGTVKEISLKTFTHLKEHEHVDLTNVRVQIGTALSQEKFEVDEDVYTKFKTLGYANDWMYFKDATQKYHIDNQQTVKKQCELAGIPAENITIENVCTFKSDSGFSYRQHKQAGRHLSFIVRK
Xiang Guo et al. (2016) β€” Characterization of a Highly Thermostable and Organic Solvent-Tolerant Copper-Containing Polyphenol Oxidase with Dye-Decolorizing Ability from Kurthia huakuii LAM0618T
PLOS ONE  Β· doi:10.1371/journal.pone.0164810 β†—  Β· Activity + Stability - Incubation
15 measurements
Database ID
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (15 measurements)

15 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity + Stability - Incubation Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (produced quinone absorbance measurement, 468 nm) in the presence of organic solvent Methanol 10 % v/v 100.0 102.14 % Direct Continuous Incubation: 50 mM phosphate buffe, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 4Β°C, Assay: 65Β°C 2 mM 2,6-Dimethoxyphenol 2,6-dimethoxy-1,4-benzoquinone 0.2 mM Cu²⁺ β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Activity + Stability - Incubation Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (produced quinone absorbance measurement, 468 nm) in the presence of organic solvent Methanol 20 % v/v 100.0 94.8 % Direct Continuous Incubation: 50 mM phosphate buffe, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 4Β°C, Assay: 65Β°C 2 mM 2,6-Dimethoxyphenol 2,6-dimethoxy-1,4-benzoquinone 0.2 mM Cu²⁺ β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Activity + Stability - Incubation Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (produced quinone absorbance measurement, 468 nm) in the presence of organic solvent Methanol 30 % v/v 100.0 91.57 % Direct Continuous Incubation: 50 mM phosphate buffe, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 4Β°C, Assay: 65Β°C 2 mM 2,6-Dimethoxyphenol 2,6-dimethoxy-1,4-benzoquinone 0.2 mM Cu²⁺ β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Activity + Stability - Incubation Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (produced quinone absorbance measurement, 468 nm) in the presence of organic solvent Ethanol 10 % v/v 100.0 125.39 % Direct Continuous Incubation: 50 mM phosphate buffe, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 4Β°C, Assay: 65Β°C 2 mM 2,6-Dimethoxyphenol 2,6-dimethoxy-1,4-benzoquinone 0.2 mM Cu²⁺ β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Activity + Stability - Incubation Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (produced quinone absorbance measurement, 468 nm) in the presence of organic solvent Ethanol 20 % v/v 100.0 90.79 % Direct Continuous Incubation: 50 mM phosphate buffe, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 4Β°C, Assay: 65Β°C 2 mM 2,6-Dimethoxyphenol 2,6-dimethoxy-1,4-benzoquinone 0.2 mM Cu²⁺ β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Activity + Stability - Incubation Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (produced quinone absorbance measurement, 468 nm) in the presence of organic solvent Ethanol 30 % v/v 100.0 57.83 % Direct Continuous Incubation: 50 mM phosphate buffe, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 4Β°C, Assay: 65Β°C 2 mM 2,6-Dimethoxyphenol 2,6-dimethoxy-1,4-benzoquinone 0.2 mM Cu²⁺ β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Activity + Stability - Incubation Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (produced quinone absorbance measurement, 468 nm) in the presence of organic solvent Isopropanol 10 % v/v 100.0 137.16 % Direct Continuous Incubation: 50 mM phosphate buffe, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 4Β°C, Assay: 65Β°C 2 mM 2,6-Dimethoxyphenol 2,6-dimethoxy-1,4-benzoquinone 0.2 mM Cu²⁺ β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Activity + Stability - Incubation Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (produced quinone absorbance measurement, 468 nm) in the presence of organic solvent Isopropanol 20 % v/v 100.0 94.21 % Direct Continuous Incubation: 50 mM phosphate buffe, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 4Β°C, Assay: 65Β°C 2 mM 2,6-Dimethoxyphenol 2,6-dimethoxy-1,4-benzoquinone 0.2 mM Cu²⁺ β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Activity + Stability - Incubation Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (produced quinone absorbance measurement, 468 nm) in the presence of organic solvent Isopropanol 30 % v/v 100.0 41.59 % Direct Continuous Incubation: 50 mM phosphate buffe, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 4Β°C, Assay: 65Β°C 2 mM 2,6-Dimethoxyphenol 2,6-dimethoxy-1,4-benzoquinone 0.2 mM Cu²⁺ β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Activity + Stability - Incubation Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (produced quinone absorbance measurement, 468 nm) in the presence of organic solvent 1-Butanol 10 % v/v 100.0 112.91 % Direct Continuous Incubation: 50 mM phosphate buffe, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 4Β°C, Assay: 65Β°C 2 mM 2,6-Dimethoxyphenol 2,6-dimethoxy-1,4-benzoquinone 0.2 mM Cu²⁺ β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Activity + Stability - Incubation Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (produced quinone absorbance measurement, 468 nm) in the presence of organic solvent 1-Butanol 20 % v/v 100.0 132.3 % Direct Continuous Incubation: 50 mM phosphate buffe, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 4Β°C, Assay: 65Β°C 2 mM 2,6-Dimethoxyphenol 2,6-dimethoxy-1,4-benzoquinone 0.2 mM Cu²⁺ β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Activity + Stability - Incubation Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (produced quinone absorbance measurement, 468 nm) in the presence of organic solvent 1-Butanol 30 % v/v 100.0 124.17 % Direct Continuous Incubation: 50 mM phosphate buffe, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 4Β°C, Assay: 65Β°C 2 mM 2,6-Dimethoxyphenol 2,6-dimethoxy-1,4-benzoquinone 0.2 mM Cu²⁺ β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Activity + Stability - Incubation Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (produced quinone absorbance measurement, 468 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10 % v/v 100.0 153.23 % Direct Continuous Incubation: 50 mM phosphate buffe, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 4Β°C, Assay: 65Β°C 2 mM 2,6-Dimethoxyphenol 2,6-dimethoxy-1,4-benzoquinone 0.2 mM Cu²⁺ β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Activity + Stability - Incubation Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (produced quinone absorbance measurement, 468 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20 % v/v 100.0 31.35 % Direct Continuous Incubation: 50 mM phosphate buffe, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 4Β°C, Assay: 65Β°C 2 mM 2,6-Dimethoxyphenol 2,6-dimethoxy-1,4-benzoquinone 0.2 mM Cu²⁺ β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Activity + Stability - Incubation Activity after incubation (30 minutes at 4Β°C), measured by absorbance spectrophotometry (produced quinone absorbance measurement, 468 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 30 % v/v 100.0 22.95 % Direct Continuous Incubation: 50 mM phosphate buffe, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 4Β°C, Assay: 65Β°C 2 mM 2,6-Dimethoxyphenol 2,6-dimethoxy-1,4-benzoquinone 0.2 mM Cu²⁺ β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase

Visualization : Activity + Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*