Sortase A (gene SrtA) from Staphylococcus aureus

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 206 amino acids
MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK
Zhimeng Wu et al. (2017) β€” Efficient expression of sortase A from Staphylococcus aureus in Escherichia coli and its enzymatic characterizations
Bioresources and Bioprocessing  Β· doi:10.1186/s40643-017-0143-y β†—  Β· Activity - Classical
25 measurements
Database ID
UniProt: Q2FV99 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (25 measurements)

25 measurements β€” page 2 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent Ethanol 10 % v/v 100 58 % Digital Continuous 50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2 7.8 37Β°C 0.5 Mg Dabcyl-QALPETGEE-Edans Dabcyl-QALPET , GEE-Edans β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent Methanol 50 % v/v 100 0 % Digital Continuous 50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2 7.8 37Β°C 0.5 Mg Dabcyl-QALPETGEE-Edans Dabcyl-QALPET , GEE-Edans β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent Methanol 40 % v/v 100 4 % Digital Continuous 50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2 7.8 37Β°C 0.5 Mg Dabcyl-QALPETGEE-Edans Dabcyl-QALPET , GEE-Edans β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent Methanol 30 % v/v 100 18 % Digital Continuous 50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2 7.8 37Β°C 0.5 Mg Dabcyl-QALPETGEE-Edans Dabcyl-QALPET , GEE-Edans β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by fluorescence spectrophotometry (cleavage separates dabcyl quencher from edans acceptor, thus removing the quencher and increasing fluoresccence, 350 nm excitation, 495 nm measurement) in the presence of organic solvent Methanol 20 % v/v 100 61 % Digital Continuous 50 mM Tris–HCl buffer, 150 mM NaCl, 30 mM CaCl2 7.8 37Β°C 0.5 Mg Dabcyl-QALPETGEE-Edans Dabcyl-QALPET , GEE-Edans β€” β€” Classical aqueous control (in %)
1 2
Next β€Ί

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*