B3-ta amine transaminase from a hot spring metagenomic library

Enzyme Description

Species
Na (hot spring metagenomic library)
Extremophile
Yes thermophilic organism (from a hot spring)
EC Number

Sequence

Length: 455 amino acids
MQVETWNAAELVRKDIRHHLHPVTNLHQLRREGPLVLVRGEGSWVWDAEGHRYLDGFAGLWNVNIGHGRVELAEAARAQMERIAFAPTFFGIASPPTIELAARLAELFPDPLNVFQFTSGGAESNETAIKIARYYWWLKGQPERIKILSRRMAYHGIAMGALSATGVPSYWEGFGPRPPGFIHLTAPYKYRFGEGLSDEEFVARLVQELEETIQREGPETIAAFIGEPVQGAGGVVVPPEGYWPAIAAVLRRYGILLILDEVITGFGRTGTLFGMQQYGIVPDIVSFAKGITSGYVPLGGVGVSDEIADTLASADRVFMHGFTYSGHPVACAVALRNLEILLAERLWENAAEAGSYLLNELRRLEERPYVGEVRGKGLMLLVEVVRDKATKEKFPPEFKLGPKLEAATRRRGVIVRCTPDGIIMAPPLTITREECDVLIEAVAGALSDVLDREYA
Erica Elisa Ferrandi et al. (2017) β€” Novel thermostable amine transferases from hot spring metagenomes
Applied Microbiology and Biotechnology  Β· doi:10.1007/s00253-017-8228-2 β†—  Β· Stability - Incubation
12 measurements
Database ID
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli Rosetta

Experimental Data (12 measurements)

12 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in aqueous phase Methanol 5 % v/v 100 92 % Digital Continuous Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer, 0.25% DMSO (Dimethyl Sulfoxide) Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 20Β°C 2.5 mM (S)-1-Phenylethylamine, 2.5 mM Pyruvate Acetophenone , L-Alanine β€” β€” Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in aqueous phase Methanol 10 % v/v 100 75 % Digital Continuous Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer, 0.25% DMSO (Dimethyl Sulfoxide) Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 20Β°C 2.5 mM (S)-1-Phenylethylamine, 2.5 mM Pyruvate Acetophenone , L-Alanine β€” β€” Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in aqueous phase Methanol 20 % v/v 100 70 % Digital Continuous Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer, 0.25% DMSO (Dimethyl Sulfoxide) Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 20Β°C 2.5 mM (S)-1-Phenylethylamine, 2.5 mM Pyruvate Acetophenone , L-Alanine β€” β€” Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in aqueous phase Ethanol 5 % v/v 100 100 % Digital Continuous Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer, 0.25% DMSO (Dimethyl Sulfoxide) Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 20Β°C 2.5 mM (S)-1-Phenylethylamine, 2.5 mM Pyruvate Acetophenone , L-Alanine β€” β€” Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in aqueous phase Ethanol 10 % v/v 100 75 % Digital Continuous Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer, 0.25% DMSO (Dimethyl Sulfoxide) Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 20Β°C 2.5 mM (S)-1-Phenylethylamine, 2.5 mM Pyruvate Acetophenone , L-Alanine β€” β€” Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in aqueous phase Ethanol 20 % v/v 100 21 % Digital Continuous Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer, 0.25% DMSO (Dimethyl Sulfoxide) Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 20Β°C 2.5 mM (S)-1-Phenylethylamine, 2.5 mM Pyruvate Acetophenone , L-Alanine β€” β€” Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 5 % v/v 100 100 % Digital Continuous Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer, 0.25% DMSO (Dimethyl Sulfoxide) Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 20Β°C 2.5 mM (S)-1-Phenylethylamine, 2.5 mM Pyruvate Acetophenone , L-Alanine β€” β€” Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 10 % v/v 100 70 % Digital Continuous Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer, 0.25% DMSO (Dimethyl Sulfoxide) Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 20Β°C 2.5 mM (S)-1-Phenylethylamine, 2.5 mM Pyruvate Acetophenone , L-Alanine β€” β€” Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 20 % v/v 100 62 % Digital Continuous Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer, 0.25% DMSO (Dimethyl Sulfoxide) Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 20Β°C 2.5 mM (S)-1-Phenylethylamine, 2.5 mM Pyruvate Acetophenone , L-Alanine β€” β€” Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in aqueous phase Acetonitrile 5 % v/v 100 83 % Digital Continuous Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer, 0.25% DMSO (Dimethyl Sulfoxide) Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 20Β°C 2.5 mM (S)-1-Phenylethylamine, 2.5 mM Pyruvate Acetophenone , L-Alanine β€” β€” Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in aqueous phase Acetonitrile 10 % v/v 100 50 % Digital Continuous Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer, 0.25% DMSO (Dimethyl Sulfoxide) Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 20Β°C 2.5 mM (S)-1-Phenylethylamine, 2.5 mM Pyruvate Acetophenone , L-Alanine β€” β€” Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (5 hours at 25Β°C), measured by absorbance spectrophotometry (acetophenone absorbance measurement, 245 nm) in aqueous phase Acetonitrile 20 % v/v 100 42 % Digital Continuous Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer, 0.25% DMSO (Dimethyl Sulfoxide) Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 20Β°C 2.5 mM (S)-1-Phenylethylamine, 2.5 mM Pyruvate Acetophenone , L-Alanine β€” β€” Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*