N-terminal truncated aminopeptidase (gene LapB) from Legionella pneumophila

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 281 amino acids
PINHEAQVHSLFEQIDPAKIWQTNQHLTSYINRSAKSRTGVEAAQWFKQQFDTLAQDYGRKDVESYFVKTGNKFIQPSVVTVIGKDKPGEAIVIGAHIDTLDGNMPGADDDSSGISVELEMARVVFSSNFELNRPIYFIAYAAEERGLIGSGYVVQDFLQKKIPVKAVMQLDQAGYRANAKDQTIWLLKDYVDKGLTEFTAELLTRYVKTPVGYTKCGYACSDHVNWTNEGFKTTYPSATTLDDDNPYVHTSNDTLDILNLEHMVNFTKLGLAFIVELGLN
Nannan Zhang et al. (2017) β€” Crystal Structure and Biochemical Characterization of an Aminopeptidase LapB from Legionella pneumophila
Journal of Agricultural and Food Chemistry  Β· doi:10.1021/acs.jafc.7b02849 β†—  Β· Activity - Classical
10 measurements
Database ID
UniProt: Q5ZZH8 β†—
Sequence Annotation
Explicit - Provided (116 first residues from the UniProt sequence absent from the mature protein)
Protein Source
Recombinant, host bacterium Escherichia coli Rosetta

Experimental Data (10 measurements)

10 measurements
Mutation Property Assay Solvent Solvent Volume Aqueous ReferenceWT Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
DEL1-92 Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroanilide absorbance measurement, 405 nm) in the presence of organic solvent Isopropanol 20 % v/v 100.0 β€” 76.1 % Digital Continuous 50 mM Tris-HCl buffer 8 37Β°C 2 mM L-Lysine p-nitroanilide L-Lysine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
DEL1-92 Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroanilide absorbance measurement, 405 nm) in the presence of organic solvent Isopropanol 60 % v/v 100.0 β€” 44.8 % Digital Continuous 50 mM Tris-HCl buffer 8 37Β°C 2 mM L-Lysine p-nitroanilide L-Lysine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
DEL1-92 Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroanilide absorbance measurement, 405 nm) in the presence of organic solvent 1-Propanol 20 % v/v 100.0 β€” 83.2 % Digital Continuous 50 mM Tris-HCl buffer 8 37Β°C 2 mM L-Lysine p-nitroanilide L-Lysine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
DEL1-92 Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroanilide absorbance measurement, 405 nm) in the presence of organic solvent 1-Propanol 60 % v/v 100.0 β€” 40.1 % Digital Continuous 50 mM Tris-HCl buffer 8 37Β°C 2 mM L-Lysine p-nitroanilide L-Lysine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
DEL1-92 Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroanilide absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 20 % v/v 100.0 β€” 159.3 % Digital Continuous 50 mM Tris-HCl buffer 8 37Β°C 2 mM L-Lysine p-nitroanilide L-Lysine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
DEL1-92 Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroanilide absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 60 % v/v 100.0 β€” 67.9 % Digital Continuous 50 mM Tris-HCl buffer 8 37Β°C 2 mM L-Lysine p-nitroanilide L-Lysine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
DEL1-92 Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroanilide absorbance measurement, 405 nm) in the presence of organic solvent Methanol 20 % v/v 100.0 β€” 92.1 % Digital Continuous 50 mM Tris-HCl buffer 8 37Β°C 2 mM L-Lysine p-nitroanilide L-Lysine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
DEL1-92 Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroanilide absorbance measurement, 405 nm) in the presence of organic solvent Methanol 60 % v/v 100.0 β€” 71.4 % Digital Continuous 50 mM Tris-HCl buffer 8 37Β°C 2 mM L-Lysine p-nitroanilide L-Lysine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
DEL1-92 Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroanilide absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 20 % v/v 100.0 β€” 74.4 % Digital Continuous 50 mM Tris-HCl buffer 8 37Β°C 2 mM L-Lysine p-nitroanilide L-Lysine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
DEL1-92 Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroanilide absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 60 % v/v 100.0 β€” 22.4 % Digital Continuous 50 mM Tris-HCl buffer 8 37Β°C 2 mM L-Lysine p-nitroanilide L-Lysine , p-Nitroaniline β€” β€” Classical aqueous control (in %)

Mutations in this dataset (1)

DEL1-92

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*