Lipase (gene Lip_BA) from Bacillus amyloliquefaciens Nsic-8
Enzyme Description
Extremophile
No
EC Number
3.1.1.3 β (transesterification activity)
Sequence
MKHIKSKILVILTVCMLSVISVFAFQPTESKASSGHNPVVMVHGIGGASFNFAGIKTYLASQGWSRKEMYAIDFLDKTGNNRHNAPRLSNYVKKVLSETGAKKVDIVAHSMGGANTLYYIKNLDGGDKIANVVTLGGANGLVTNRALPGTDPNQKILYTSIYSSADLIVLNPLSRLIGGKNVQIHGVGHIGLLMNSQVNGLIKEGLNGGGQNTN
Fengying Dong et al. (2017)
β Transesterification Synthesis of Chloramphenicol Esters with the Lipase from Bacillus amyloliquefaciens
Molecules
Β· doi:10.3390/molecules22091523 β
Β· Activity + Stability - Conversion
▼
Database ID
UniProt: R9XUI2 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Purified, bacterium Bacillus amyloliquefaciens
Experimental Data (7 measurements)
7 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity + Stability - Conversion | Conversion after incubation (4 hours at 50Β°C) in the presence of organic solvent, measured by HPLC | Toluene | 100 % v/v | 0 | 50 | % | Direct | Continuous | β | β | 50Β°C | 0.25 M Chloramphenicol, 1.25 M Vinyl propanoate | Acetaldehyde , Chloramphenicol-3-propionate | β | 200 rpm | Classical aqueous control (in %) | Conflicting information about temperature (40Β°C figure/50Β°C text)/Transesterification activity measured |
| Activity + Stability - Conversion | Conversion after incubation (4 hours at 50Β°C) in the presence of organic solvent, measured by HPLC | 1,4-Dioxane | 100 % v/v | 0 | 89 | % | Direct | Continuous | β | β | 50Β°C | 0.25 M Chloramphenicol, 1.25 M Vinyl propanoate | Acetaldehyde , Chloramphenicol-3-propionate | β | 200 rpm | Classical aqueous control (in %) | Conflicting information about temperature (40Β°C figure/50Β°C text)/Transesterification activity measured |
| Activity + Stability - Conversion | Conversion after incubation (4 hours at 50Β°C) in the presence of organic solvent, measured by HPLC | Tetrahydrofuran (THF) | 100 % v/v | 0 | 70 | % | Direct | Continuous | β | β | 50Β°C | 0.25 M Chloramphenicol, 1.25 M Vinyl propanoate | Acetaldehyde , Chloramphenicol-3-propionate | β | 200 rpm | Classical aqueous control (in %) | Conflicting information about temperature (40Β°C figure/50Β°C text)/Transesterification activity measured |
| Activity + Stability - Conversion | Conversion after incubation (4 hours at 50Β°C) in the presence of organic solvent, measured by HPLC | Dichloromethane | 100 % v/v | 0 | 60 | % | Direct | Continuous | β | β | 50Β°C | 0.25 M Chloramphenicol, 1.25 M Vinyl propanoate | Acetaldehyde , Chloramphenicol-3-propionate | β | 200 rpm | Classical aqueous control (in %) | Conflicting information about temperature (40Β°C figure/50Β°C text)/Transesterification activity measured |
| Activity + Stability - Conversion | Conversion after incubation (4 hours at 50Β°C) in the presence of organic solvent, measured by HPLC | Acetone | 100 % v/v | 0 | 72 | % | Direct | Continuous | β | β | 50Β°C | 0.25 M Chloramphenicol, 1.25 M Vinyl propanoate | Acetaldehyde , Chloramphenicol-3-propionate | β | 200 rpm | Classical aqueous control (in %) | Conflicting information about temperature (40Β°C figure/50Β°C text)/Transesterification activity measured |
| Activity + Stability - Conversion | Conversion after incubation (4 hours at 50Β°C) in the presence of organic solvent, measured by HPLC | Acetonitrile | 100 % v/v | 0 | 80 | % | Direct | Continuous | β | β | 50Β°C | 0.25 M Chloramphenicol, 1.25 M Vinyl propanoate | Acetaldehyde , Chloramphenicol-3-propionate | β | 200 rpm | Classical aqueous control (in %) | Conflicting information about temperature (40Β°C figure/50Β°C text)/Transesterification activity measured |
| Activity + Stability - Conversion | Conversion after incubation (4 hours at 50Β°C) in the presence of organic solvent, measured by HPLC | Ethanol | 100 % v/v | 0 | 81 | % | Direct | Continuous | β | β | 50Β°C | 0.25 M Chloramphenicol, 1.25 M Vinyl propanoate | Acetaldehyde , Chloramphenicol-3-propionate | β | 200 rpm | Classical aqueous control (in %) | Conflicting information about temperature (40Β°C figure/50Β°C text)/Transesterification activity measured |
Visualization : Activity + Stability β Conversion
One bar per measurement. Colour = solvent, shade = solvent volume.