Lipase (gene Lip_BA) from Bacillus amyloliquefaciens Nsic-8

Enzyme Description

Extremophile
No
EC Number
3.1.1.3 β†— (transesterification activity)

Sequence

Length: 214 amino acids
MKHIKSKILVILTVCMLSVISVFAFQPTESKASSGHNPVVMVHGIGGASFNFAGIKTYLASQGWSRKEMYAIDFLDKTGNNRHNAPRLSNYVKKVLSETGAKKVDIVAHSMGGANTLYYIKNLDGGDKIANVVTLGGANGLVTNRALPGTDPNQKILYTSIYSSADLIVLNPLSRLIGGKNVQIHGVGHIGLLMNSQVNGLIKEGLNGGGQNTN
Fengying Dong et al. (2017) β€” Transesterification Synthesis of Chloramphenicol Esters with the Lipase from Bacillus amyloliquefaciens
Molecules  Β· doi:10.3390/molecules22091523 β†—  Β· Activity + Stability - Conversion
7 measurements
Database ID
UniProt: R9XUI2 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Purified, bacterium Bacillus amyloliquefaciens

Experimental Data (7 measurements)

7 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity + Stability - Conversion Conversion after incubation (4 hours at 50Β°C) in the presence of organic solvent, measured by HPLC Toluene 100 % v/v 0 50 % Direct Continuous β€” β€” 50Β°C 0.25 M Chloramphenicol, 1.25 M Vinyl propanoate Acetaldehyde , Chloramphenicol-3-propionate β€” 200 rpm Classical aqueous control (in %) | Conflicting information about temperature (40Β°C figure/50Β°C text)/Transesterification activity measured
Activity + Stability - Conversion Conversion after incubation (4 hours at 50Β°C) in the presence of organic solvent, measured by HPLC 1,4-Dioxane 100 % v/v 0 89 % Direct Continuous β€” β€” 50Β°C 0.25 M Chloramphenicol, 1.25 M Vinyl propanoate Acetaldehyde , Chloramphenicol-3-propionate β€” 200 rpm Classical aqueous control (in %) | Conflicting information about temperature (40Β°C figure/50Β°C text)/Transesterification activity measured
Activity + Stability - Conversion Conversion after incubation (4 hours at 50Β°C) in the presence of organic solvent, measured by HPLC Tetrahydrofuran (THF) 100 % v/v 0 70 % Direct Continuous β€” β€” 50Β°C 0.25 M Chloramphenicol, 1.25 M Vinyl propanoate Acetaldehyde , Chloramphenicol-3-propionate β€” 200 rpm Classical aqueous control (in %) | Conflicting information about temperature (40Β°C figure/50Β°C text)/Transesterification activity measured
Activity + Stability - Conversion Conversion after incubation (4 hours at 50Β°C) in the presence of organic solvent, measured by HPLC Dichloromethane 100 % v/v 0 60 % Direct Continuous β€” β€” 50Β°C 0.25 M Chloramphenicol, 1.25 M Vinyl propanoate Acetaldehyde , Chloramphenicol-3-propionate β€” 200 rpm Classical aqueous control (in %) | Conflicting information about temperature (40Β°C figure/50Β°C text)/Transesterification activity measured
Activity + Stability - Conversion Conversion after incubation (4 hours at 50Β°C) in the presence of organic solvent, measured by HPLC Acetone 100 % v/v 0 72 % Direct Continuous β€” β€” 50Β°C 0.25 M Chloramphenicol, 1.25 M Vinyl propanoate Acetaldehyde , Chloramphenicol-3-propionate β€” 200 rpm Classical aqueous control (in %) | Conflicting information about temperature (40Β°C figure/50Β°C text)/Transesterification activity measured
Activity + Stability - Conversion Conversion after incubation (4 hours at 50Β°C) in the presence of organic solvent, measured by HPLC Acetonitrile 100 % v/v 0 80 % Direct Continuous β€” β€” 50Β°C 0.25 M Chloramphenicol, 1.25 M Vinyl propanoate Acetaldehyde , Chloramphenicol-3-propionate β€” 200 rpm Classical aqueous control (in %) | Conflicting information about temperature (40Β°C figure/50Β°C text)/Transesterification activity measured
Activity + Stability - Conversion Conversion after incubation (4 hours at 50Β°C) in the presence of organic solvent, measured by HPLC Ethanol 100 % v/v 0 81 % Direct Continuous β€” β€” 50Β°C 0.25 M Chloramphenicol, 1.25 M Vinyl propanoate Acetaldehyde , Chloramphenicol-3-propionate β€” 200 rpm Classical aqueous control (in %) | Conflicting information about temperature (40Β°C figure/50Β°C text)/Transesterification activity measured

Visualization : Activity + Stability β€” Conversion

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*