GH134 Ξ²-1,4-mannanase SsGH134 from Streptomyces sp. NRRL B-24484
Enzyme Description
Extremophile
No
but "thermostable" and "pH-tolerant" enzyme
EC Number
Sequence
ETAPNGYPYCANGSASDPDGDGWGWENNRSCVVRTGSGSGSGSGSSACPSGATCGSYTVGGLGSRKQQVRNAGGSSLDLAVAMLETERMDTAYPYGDNKSGDAANFGIFKQNWLMLRSACAQFGGQGAGQYDNGAALNSSLGQDVSCLHQSQSHYGLDAWFAGHRNGASGLSSPNTADIAAYKAAVYWIKAQLDADSANLGNDTRFWVQVPAI
Kiyota Sakai et al. (2018)
β Characterization of pH-tolerant and thermostable GH 134 Ξ²-1,4-mannanase SsGH134 possessing carbohydrate binding module 10 from Streptomyces sp. NRRL B-24484
Journal of Bioscience and Bioengineering
Β· doi:10.1016/j.jbiosc.2017.10.009 β
Β· Stability - Incubation
▼
Database ID
UniParc: UPI0004C15D82 β
Sequence Annotation
Explicit - Provided GenBank Accession Number (28 first residues from UniProt sequence absent from the mature protein)
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (4 measurements)
4 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (DNS assay) in aqueous phase | Methanol | 20 % v/v | 100 | 78 | % | Digital | Continuous | ? | Incubation: 6, Assay: ? | Incubation: 30Β°C, Assay: 37Β°C | 0.5% (w/v) Glucomannan | Reducing sugars | β | β | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (DNS assay) in aqueous phase | Ethanol | 20 % v/v | 100 | 85 | % | Digital | Continuous | ? | Incubation: 6, Assay: ? | Incubation: 30Β°C, Assay: 37Β°C | 0.5% (w/v) Glucomannan | Reducing sugars | β | β | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (DNS assay) in aqueous phase | Isopropanol | 20 % v/v | 100 | 65 | % | Digital | Continuous | ? | Incubation: 6, Assay: ? | Incubation: 30Β°C, Assay: 37Β°C | 0.5% (w/v) Glucomannan | Reducing sugars | β | β | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (DNS assay) in aqueous phase | Acetone | 20 % v/v | 100 | 100 | % | Digital | Continuous | ? | Incubation: 6, Assay: ? | Incubation: 30Β°C, Assay: 37Β°C | 0.5% (w/v) Glucomannan | Reducing sugars | β | β | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.