Esterase (gene e69) from Erythrobacter seohaensis SW-135
Enzyme Description
Extremophile
No
but "halotolerant" and "thermoalkalophilic" enzyme
EC Number
Sequence
MRDHGERFVVEAEERRTVSIERTNLGGVNIAWVSPSDKVPSSDGPLIFNLHDGGFALNDGDAALYTAVSFAELQQLDSVSVDYRLTPQHPYPAALEDAVAAYAVIKRKMPGRPIVVYGLSAGGGLGAAFLLKVKQLGLPMPEAAVLNSPWSDVSMNSDTLATLDCYDPLLGGSRPTLKPLANSYAAGADPQDPLVSPVYGDWEGVDVPVLLISGTRDVMLGDTVRLHRAMWRAGVPAELIVNEGMWHAFSVEPEFEAMIADSARFIRHISAKED
Ying-Yi Huo et al. (2017)
β A Novel Halotolerant Thermoalkaliphilic Esterase from Marine Bacterium Erythrobacter seohaensis SW-135
Frontiers in Microbiology
Β· doi:10.3389/fmicb.2017.02315 β
Β· Activity - Classical
▼
Database ID
UniParc: UPI000CA3B563 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (16 measurements)
16 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetone | 5 % v/v | 100.0 | 59.6 | % | Direct | Continuous | 50 mM CHES buffer | 10 | 40Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetonitrile | 5 % v/v | 100.0 | 85.4 | % | Direct | Continuous | 50 mM CHES buffer | 10 | 40Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethanol | 5 % v/v | 100.0 | 90.3 | % | Direct | Continuous | 50 mM CHES buffer | 10 | 40Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 5 % v/v | 100.0 | 74.8 | % | Direct | Continuous | 50 mM CHES buffer | 10 | 40Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 5 % v/v | 100.0 | 42.1 | % | Direct | Continuous | 50 mM CHES buffer | 10 | 40Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Glycerol | 5 % v/v | 100.0 | 121.7 | % | Direct | Continuous | 50 mM CHES buffer | 10 | 40Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isopropanol | 5 % v/v | 100.0 | 91.3 | % | Direct | Continuous | 50 mM CHES buffer | 10 | 40Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 5 % v/v | 100.0 | 0.0 | % | Direct | Continuous | 50 mM CHES buffer | 10 | 40Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetone | 15 % v/v | 100.0 | 8.9 | % | Direct | Continuous | 50 mM CHES buffer | 10 | 40Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetonitrile | 15 % v/v | 100.0 | 35.0 | % | Direct | Continuous | 50 mM CHES buffer | 10 | 40Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethanol | 15 % v/v | 100.0 | 13.9 | % | Direct | Continuous | 50 mM CHES buffer | 10 | 40Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 15 % v/v | 100.0 | 17.1 | % | Direct | Continuous | 50 mM CHES buffer | 10 | 40Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 15 % v/v | 100.0 | 30.3 | % | Direct | Continuous | 50 mM CHES buffer | 10 | 40Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Glycerol | 15 % v/v | 100.0 | 0.0 | % | Direct | Continuous | 50 mM CHES buffer | 10 | 40Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isopropanol | 15 % v/v | 100.0 | 28.8 | % | Direct | Continuous | 50 mM CHES buffer | 10 | 40Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 15 % v/v | 100.0 | 0.0 | % | Direct | Continuous | 50 mM CHES buffer | 10 | 40Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.