Esterase (gene estUT1) from Ureibacillus thermosphaericus UT1

Enzyme Description

Species
Ureibacillus thermosphaericus UT1 β†—
Extremophile
Yes "thermophilic" organism
EC Number
3.1.1.1 β†—

Sequence

Length: 248 amino acids
MKIVSPKPFTIETGKRAVLLLHGFTGNTNDVKRLGRYLADRNYTVHAPLYKGHGSDPLTLINTDPIEWWNSAVEGYDELRRRGYKEIAVAGVSLGGIFSLRLGEERPIKAIVTMSAPALSKSVDSLQQRIISYTINYKKLTGTYNEDVDKPENLAKTYRMPKLEYLQGIINDTSAKLNQIDKPVHILRGLNDDEYYCQSADYIYNSVKSRIKSVKSFINSGHILTVDKERDLVFEEVYRFFESLKWEE
Yuliya V. Samoylova et al. (2018) β€” Cloning, expression and characterization of the esterase estUT1 from Ureibacillus thermosphaericus which belongs to a new lipase family XVIII
Extremophiles  Β· doi:10.1007/s00792-018-0996-9 β†—  Β· Stability - Incubation
32 measurements ▼
Database ID
UniProt: A0A223PZA8 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (32 measurements)

32 measurements β€” page 2 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetonitrile 10 % v/v 100 99 % Digital Continuous Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase 1-Butanol 30 % v/v 100 78 % Digital Continuous Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase 1-Butanol 10 % v/v 100 96 % Digital Continuous Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 30 % v/v 100 78 % Digital Continuous Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 10 % v/v 100 97 % Digital Continuous Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Chloroform 30 % v/v 100 42 % Digital Continuous Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Chloroform 10 % v/v 100 61 % Digital Continuous Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 30 % v/v 100 65 % Digital Continuous Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 10 % v/v 100 87 % Digital Continuous Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetone 30 % v/v 100 117 % Digital Continuous Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetone 10 % v/v 100 123 % Digital Continuous Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase n-Hexane 30 % v/v 100 107 % Digital Continuous Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
β€Ή Prev
1 2
Next β€Ί

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*