Protease (gene SAPHM) from Bacillus licheniformis K7A
Enzyme Description
Species
Extremophile
Yes
"thermophilic" organism, "alkaline" enzyme
EC Number
Sequence
AQTVPQGIPLIKAEKVQAQGFDGARVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAETVAALDNTTGVLGVAPSVSLYAVKVLNSSWSGSYSGIVSGIEWATTNGMDVINMSLGGASGSTAMKQAVDNAYARGVVVVAAAGKSGSSGNTNTIGYPAKYDSVIAVGAVKSNSNRASFSSVGAELEVMAPGAGVYSTYPTNTYATLNGTSMASPHVAGAAALILSKHPRLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ
Raziqa Hadjidj et al. (2018)
β Purification, biochemical, and molecular characterization of novel protease from Bacillus licheniformis strain K7A
International Journal of Biological Macromolecules
Β· doi:10.1016/j.ijbiomac.2018.03.167 β
Β· Stability - Incubation
▼
Database ID
UniProt: A0A345FZ45 β
Sequence Annotation
Explicit - Provided (105 first residues removed from mature protein sequence)
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3) pLysS
Experimental Data (19 measurements)
19 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase | 1-Hexanol | 50 % v/v | 100 | 75 | % | Digital | Continuous | Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 70Β°C | 0.01 Casein | free amino acids , Peptides | β | Incubation: 200 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 50 % v/v | 100 | 57 | % | Digital | Continuous | Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 70Β°C | 0.01 Casein | free amino acids , Peptides | β | Incubation: 200 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase | Dimethylformamide (DMF) | 50 % v/v | 100 | 325 | % | Digital | Continuous | Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 70Β°C | 0.01 Casein | free amino acids , Peptides | β | Incubation: 200 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase | Methanol | 50 % v/v | 100 | 53 | % | Digital | Continuous | Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 70Β°C | 0.01 Casein | free amino acids , Peptides | β | Incubation: 200 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase | Ethanol | 50 % v/v | 100 | 18 | % | Digital | Continuous | Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 70Β°C | 0.01 Casein | free amino acids , Peptides | β | Incubation: 200 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase | Acetonitrile | 50 % v/v | 100 | 30 | % | Digital | Continuous | Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 70Β°C | 0.01 Casein | free amino acids , Peptides | β | Incubation: 200 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase | Isopropanol | 50 % v/v | 100 | 88 | % | Digital | Continuous | Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 70Β°C | 0.01 Casein | free amino acids , Peptides | β | Incubation: 200 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase | Isopropanol | 50 % v/v | 100 | 61 | % | Digital | Continuous | Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 70Β°C | 0.01 Casein | free amino acids , Peptides | β | Incubation: 200 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase | Ethyl Acetate | 50 % v/v | 100 | 160 | % | Digital | Continuous | Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 70Β°C | 0.01 Casein | free amino acids , Peptides | β | Incubation: 200 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase | 1-Butanol | 50 % v/v | 100 | 94 | % | Digital | Continuous | Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 70Β°C | 0.01 Casein | free amino acids , Peptides | β | Incubation: 200 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase | n-Hexadecane | 50 % v/v | 100 | 90 | % | Digital | Continuous | Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 70Β°C | 0.01 Casein | free amino acids , Peptides | β | Incubation: 200 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase | Chloroform | 50 % v/v | 100 | 243 | % | Digital | Continuous | Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 70Β°C | 0.01 Casein | free amino acids , Peptides | β | Incubation: 200 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase | Benzene | 50 % v/v | 100 | 90 | % | Digital | Continuous | Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 70Β°C | 0.01 Casein | free amino acids , Peptides | β | Incubation: 200 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase | Toluene | 50 % v/v | 100 | 81 | % | Digital | Continuous | Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 70Β°C | 0.01 Casein | free amino acids , Peptides | β | Incubation: 200 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase | Cyclohexane | 50 % v/v | 100 | 185 | % | Digital | Continuous | Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 70Β°C | 0.01 Casein | free amino acids , Peptides | β | Incubation: 200 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase | n-Hexane | 50 % v/v | 100 | 106 | % | Digital | Continuous | Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 70Β°C | 0.01 Casein | free amino acids , Peptides | β | Incubation: 200 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase | n-Heptane | 50 % v/v | 100 | 120 | % | Digital | Continuous | Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 70Β°C | 0.01 Casein | free amino acids , Peptides | β | Incubation: 200 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase | Isooctane | 50 % v/v | 100 | 99 | % | Digital | Continuous | Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 70Β°C | 0.01 Casein | free amino acids , Peptides | β | Incubation: 200 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (72 hours at 37Β°C), measured by absorbance spectrophotometry (colorimetric assay, Fiolin-Ciocalteu phenol reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase | n-Decane | 50 % v/v | 100 | 76 | % | Digital | Continuous | Incubation: ?, Assay: 83 mM glycine-NaOH buffer, 1.7 mM CaCl2 | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 70Β°C | 0.01 Casein | free amino acids , Peptides | β | Incubation: 200 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.