3-hydroxy-3-methylglutaryl coenzyme A reductase from Sulfolobus solfataricus

Enzyme Description

Extremophile
Yes "thermoacidophilic" organism
EC Number

Sequence

Length: 409 amino acids
MKIDEVVEKLVKGEISFHEVDNLLEANAAMVARRLALEKIVGVGLPSIGSTVIDYSEIKNKNAENVIGAIQIPLGIVGPIRVNGDYAKGDFYVPMATTEGALIASVNRGIKAVTLSGGVRAKVLKDEMTRAPVFKFDSIEQIPNFLKFIEENLEKIRNIANSTSHHGKLKSITPFVLGNNVWLRFSFETGDAMGMNMVTIAVEKVCEFIEENFPSADCLAVSGNMCSDKKQTNVNSLFGRGKTVVAEALIKKDVIRNILHSNAQLIHDINLRKNWLGTARAGSLSQFNAHFANIVTAIFIATGQDVAQIVESSSGYTWTEVRGEDLYISVTLPSLEVGTVGGGTRLPTQKEALSIMGVYGSGNPPGSNAKKLAEIIASTVLSGELNLLAALSNKELGKAHAKLGRAMKV
Michael Dirkmann et al. (2017) β€” A Multiperspective Approach to Solvent Regulation of Enzymatic Activity: HMG-CoA Reductase
ChemBioChem  Β· doi:10.1002/cbic.201700596 β†—  Β· Activity - Classical
79 measurements
Database ID
UniProt: O08424 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli Rosetta‐gamiTM 2(DE3)

Experimental Data (79 measurements)

79 measurements β€” page 2 of 4
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Isopropanol 40 % v/v 100 31 % Digital Continuous 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Acetone 60 % v/v 100 18 % Digital Continuous 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Acetone 50 % v/v 100 28 % Digital Continuous 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Acetone 40 % v/v 100 49 % Digital Continuous 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Acetone 30 % v/v 100 50 % Digital Continuous 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Acetone 20 % v/v 100 69 % Digital Continuous 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Acetone 10 % v/v 100 76 % Digital Continuous 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Acetone 5 % v/v 100 88 % Digital Continuous 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Isopropanol 60 % v/v 100 20 % Digital Continuous 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Isopropanol 50 % v/v 100 20 % Digital Continuous 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Methanol 20 % v/v 100 72 % Digital Continuous 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Isopropanol 30 % v/v 100 66 % Digital Continuous 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Isopropanol 20 % v/v 100 70 % Digital Continuous 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Isopropanol 15 % v/v 100 76 % Digital Continuous 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Isopropanol 10 % v/v 100 85 % Digital Continuous 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Isopropanol 5 % v/v 100 90 % Digital Continuous 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Isopropanol 2.5 % v/v 100 96 % Digital Continuous 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Dimethylformamide (DMF) 60 % v/v 100 20 % Digital Continuous 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Dimethylformamide (DMF) 50 % v/v 100 22 % Digital Continuous 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
Activity - Classical Activity measured by absorbance spectrophotometry (DTNB and released coenzyme A absorbance measurement, 412 nm) in the presence of organic solvent Dimethylformamide (DMF) 40 % v/v 100 35 % Digital Continuous 100 mM KOAc/100 mM MES buffer, 0.25 mM 5.5-dithio-bis-(2-nitrobenzoic acid) 5.5 45Β°C 0.25 mM Hydroxymethylglutaroyl coenzyme A Coenzyme A , Mevalonate 0.5 mM NADPH β€” Classical aqueous control (in %) | Racemic substrate
1 2 3 4

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*