9-cis-epoxycarotenoid dioxygenase (gene SeNCED) from Serratia sp. ATCC 39006

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 496 amino acids
MSLKFPETPEFTGLYKPSRVETQVFDLEIEGEVPPQIKGTFFQVSPDSYYPPMQGKDIFFNGDGLVSAFKFENGHVSLRRRYVQTDRLKAQWKERRSLNGIYRNIYTNDPLAAENNTTANTTVLFHAGVLLAMKEDALPYALNPNTLETLGVWDFNGQITSATFTAHPKIDPDNGDLLCFAYEAKGDGTSDIAYFEIDASGKLKKEIWFKGPYAAMIHDFAVTAHHVVFPLIPLTADVDRMKAGGQHFEWQPDLPQLFGVLPRDGSSEDVLWFHGPKDGFQGHTLNAYEEDGLLRVDMPVTNGNVFYFFPQADGSVPLPETLSSQLMRWTFNLNGPGESEAGQQTLQPQPLTSFPCEFPRCDERFTGKPYEHGFVLAFDPALPFDETLGERPFQFFNQLAHVNVRTGETETWYPGNAQCFQEPIFVPRSPDAPEGDGYVIALLNHLHGNDTELVVLDSLKMATGPVARIKVPFRLRMSLHGNWTPAEALKGTQSGR
Jiao Tang et al. (2018) β€” Expression and characterization of a 9-cis-epoxycarotenoid dioxygenase from Serratia sp. ATCC 39006 capable of biotransforming isoeugenol and 4-vinylguaiacol to vanillin
Biotechnology Reports  Β· doi:10.1016/j.btre.2018.e00253 β†—  Β· Activity - Classical Stability - Incubation
60 measurements
Database ID
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (60 measurements)

60 measurements β€” page 1 of 3
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by HPLC (vanillin production measurement) in the presence of organic solvent Chloroform 10 % v/v 100.0 176.16 % Direct Continuous 100 mM potassium phosphate buffer, 10% v/v glycerol 8 Room temperature 2 mM Isoeugenol Acetaldehyde , Vanillin Fe²⁺ Yes, "Vigorous shaking" Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (vanillin production measurement) in the presence of organic solvent Dichloromethane 10 % v/v 100.0 93.83 % Direct Continuous 100 mM potassium phosphate buffer, 10% v/v glycerol 8 Room temperature 2 mM Isoeugenol Acetaldehyde , Vanillin Fe²⁺ Yes, "Vigorous shaking" Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (vanillin production measurement) in the presence of organic solvent n-Octane 10 % v/v 100.0 70.45 % Direct Continuous 100 mM potassium phosphate buffer, 10% v/v glycerol 8 Room temperature 2 mM 4-Vinylguaiacol Acetaldehyde , Vanillin Fe²⁺ Yes, "Vigorous shaking" Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (vanillin production measurement) in the presence of organic solvent 1-Butanol 10 % v/v 100.0 21.44 % Direct Continuous 100 mM potassium phosphate buffer, 10% v/v glycerol 8 Room temperature 2 mM 4-Vinylguaiacol Acetaldehyde , Vanillin Fe²⁺ Yes, "Vigorous shaking" Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (vanillin production measurement) in the presence of organic solvent Petroleum Ether 10 % v/v 100.0 92.95 % Direct Continuous 100 mM potassium phosphate buffer, 10% v/v glycerol 8 Room temperature 2 mM 4-Vinylguaiacol Acetaldehyde , Vanillin Fe²⁺ Yes, "Vigorous shaking" Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (vanillin production measurement) in the presence of organic solvent n-Hexane 10 % v/v 100.0 86.15 % Direct Continuous 100 mM potassium phosphate buffer, 10% v/v glycerol 8 Room temperature 2 mM 4-Vinylguaiacol Acetaldehyde , Vanillin Fe²⁺ Yes, "Vigorous shaking" Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (vanillin production measurement) in the presence of organic solvent Cyclohexane 10 % v/v 100.0 122.72 % Direct Continuous 100 mM potassium phosphate buffer, 10% v/v glycerol 8 Room temperature 2 mM 4-Vinylguaiacol Acetaldehyde , Vanillin Fe²⁺ Yes, "Vigorous shaking" Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (vanillin production measurement) in the presence of organic solvent Ethyl Acetate 10 % v/v 100.0 35.06 % Direct Continuous 100 mM potassium phosphate buffer, 10% v/v glycerol 8 Room temperature 2 mM 4-Vinylguaiacol Acetaldehyde , Vanillin Fe²⁺ Yes, "Vigorous shaking" Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (vanillin production measurement) in the presence of organic solvent Toluene 10 % v/v 100.0 29.36 % Direct Continuous 100 mM potassium phosphate buffer, 10% v/v glycerol 8 Room temperature 2 mM 4-Vinylguaiacol Acetaldehyde , Vanillin Fe²⁺ Yes, "Vigorous shaking" Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (vanillin production measurement) in the presence of organic solvent 1-Octanol 10 % v/v 100.0 144.66 % Direct Continuous 100 mM potassium phosphate buffer, 10% v/v glycerol 8 Room temperature 2 mM 4-Vinylguaiacol Acetaldehyde , Vanillin Fe²⁺ Yes, "Vigorous shaking" Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (vanillin production measurement) in the presence of organic solvent Chloroform 10 % v/v 100.0 208.47 % Direct Continuous 100 mM potassium phosphate buffer, 10% v/v glycerol 8 Room temperature 2 mM 4-Vinylguaiacol Acetaldehyde , Vanillin Fe²⁺ Yes, "Vigorous shaking" Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (vanillin production measurement) in the presence of organic solvent n-Octane 10 % v/v 100.0 55.34 % Direct Continuous 100 mM potassium phosphate buffer, 10% v/v glycerol 8 Room temperature 2 mM Isoeugenol Acetaldehyde , Vanillin Fe²⁺ Yes, "Vigorous shaking" Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (vanillin production measurement) in the presence of organic solvent Dichloromethane 10 % v/v 100.0 121.97 % Direct Continuous 100 mM potassium phosphate buffer, 10% v/v glycerol 8 Room temperature 2 mM 4-Vinylguaiacol Acetaldehyde , Vanillin Fe²⁺ Yes, "Vigorous shaking" Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (vanillin production measurement) in the presence of organic solvent 1-Octanol 10 % v/v 100.0 74.73 % Direct Continuous 100 mM potassium phosphate buffer, 10% v/v glycerol 8 Room temperature 2 mM Isoeugenol Acetaldehyde , Vanillin Fe²⁺ Yes, "Vigorous shaking" Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (vanillin production measurement) in the presence of organic solvent Toluene 10 % v/v 100.0 39.56 % Direct Continuous 100 mM potassium phosphate buffer, 10% v/v glycerol 8 Room temperature 2 mM Isoeugenol Acetaldehyde , Vanillin Fe²⁺ Yes, "Vigorous shaking" Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (vanillin production measurement) in the presence of organic solvent Ethyl Acetate 10 % v/v 100.0 19.35 % Direct Continuous 100 mM potassium phosphate buffer, 10% v/v glycerol 8 Room temperature 2 mM Isoeugenol Acetaldehyde , Vanillin Fe²⁺ Yes, "Vigorous shaking" Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (vanillin production measurement) in the presence of organic solvent Cyclohexane 10 % v/v 100.0 91.01 % Direct Continuous 100 mM potassium phosphate buffer, 10% v/v glycerol 8 Room temperature 2 mM Isoeugenol Acetaldehyde , Vanillin Fe²⁺ Yes, "Vigorous shaking" Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (vanillin production measurement) in the presence of organic solvent n-Hexane 10 % v/v 100.0 84.29 % Direct Continuous 100 mM potassium phosphate buffer, 10% v/v glycerol 8 Room temperature 2 mM Isoeugenol Acetaldehyde , Vanillin Fe²⁺ Yes, "Vigorous shaking" Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (vanillin production measurement) in the presence of organic solvent Petroleum Ether 10 % v/v 100.0 46.05 % Direct Continuous 100 mM potassium phosphate buffer, 10% v/v glycerol 8 Room temperature 2 mM Isoeugenol Acetaldehyde , Vanillin Fe²⁺ Yes, "Vigorous shaking" Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (vanillin production measurement) in the presence of organic solvent 1-Butanol 10 % v/v 100.0 38.19 % Direct Continuous 100 mM potassium phosphate buffer, 10% v/v glycerol 8 Room temperature 2 mM Isoeugenol Acetaldehyde , Vanillin Fe²⁺ Yes, "Vigorous shaking" Classical aqueous control (in %)
β€Ή Prev
1 2 3

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*