Carbonyl reductase from Rhodococcus erythropolis WZ010

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 348 amino acids
MKAIQYTRIGAEPELTEIPKPEPGPGEVLLEVTAAGVCHSDDFIMSLPEEQYTYGLPLTLGHEGAGRVAAVGEGVEGLDIGTNVVVYGPWGCGSCWHCSQGLENYCSRAKELGINPPGLGAPGALAEFMIVDSPRHLVPIGDLDPVKTVPLTDAGLTPYHAIKRSLPKLRGGSYAVVIGTGGLGHVAIQLLRHLSAATVIALDVSADKLELATKVGAHEVVLSDKDAAENVRSITGSQGAALVLDFVGYQPTIDTAMAVAGVGSDVTIVGIGDGQAHAKVGFFQSPYEASVTVPYWGARNELIELIDLAHAGIFDIAVETFSLDNGAEAYRRLAAGTLSGRAVVVPGL
Xiangxian Ying et al. (2018) β€” Characterization of a Carbonyl Reductase from Rhodococcus erythropolis WZ010 and Its Variant Y54F for Asymmetric Synthesis of (S)-N-Boc-3-Hydroxypiperidine
Molecules  Β· doi:10.3390/molecules23123117 β†—  Β· Stability - Incubation
4 measurements
Database ID
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (4 measurements)

4 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (3.5 hours at 35Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in aqueous phase 2-Octanol 40 % v/v 100 68 % Digital Continuous ? Incubation, 50 mM PIPES buffer Incubation: ?, Assay: 6 Incubation: 35Β°C, Assay: 60Β°C 10 mM 1-Boc-3-piperidone (S)-N-Boc-3-hydroxypiperidine 0.4 mM NADH β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent, uncertainty about control, uncertainty about EC number
Stability - Incubation Activity after incubation (3.5 hours at 35Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in aqueous phase Isopropanol 20 % v/v 100 29 % Digital Continuous ? Incubation, 50 mM PIPES buffer Incubation: ?, Assay: 6 Incubation: 35Β°C, Assay: 60Β°C 10 mM 1-Boc-3-piperidone (S)-N-Boc-3-hydroxypiperidine 0.4 mM NADH β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent, uncertainty about control, uncertainty about EC number
Stability - Incubation Activity after incubation (3.5 hours at 35Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in aqueous phase Acetone 20 % v/v 100 59 % Digital Continuous ? Incubation, 50 mM PIPES buffer Incubation: ?, Assay: 6 Incubation: 35Β°C, Assay: 60Β°C 10 mM 1-Boc-3-piperidone (S)-N-Boc-3-hydroxypiperidine 0.4 mM NADH β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent, uncertainty about control, uncertainty about EC number
Stability - Incubation Activity after incubation (3.5 hours at 35Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in aqueous phase 2-Octanone 40 % v/v 100 58 % Digital Continuous ? Incubation, 50 mM PIPES buffer Incubation: ?, Assay: 6 Incubation: 35Β°C, Assay: 60Β°C 10 mM 1-Boc-3-piperidone (S)-N-Boc-3-hydroxypiperidine 0.4 mM NADH β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent, uncertainty about control, uncertainty about EC number

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*