NAD(P) dependent formate dehydrogenase (gene fdh) from Burkholderia dolosa PC543

Enzyme Description

Species
Burkholderia dolosa PC543 β†—
Extremophile
No but organic "solvent-tolerant" and "acidic-tolerant" enzyme
EC Number
1.2.1.2 β†—

Sequence

Length: 386 amino acids
MATVLCVLYPDPVDGYPPHYVRDTIPVITRYADGQTAPTPAGPPGFRPGELVGSVSGALGLRGYLEAHGHTLIVTSDKDGPDSEFERRLPDADVVISQPFWPAYLTAERIARAPKLRLALTAGIGSDHVDLDAAARAHITVAEVTGSNSISVAEHVVMTTLALVRNYLPSHAIAQQGGWNIADCVSRSYDVEGMHFGTVGAGRIGLAVLRRLKPFGLHLHYTQRHRLDAAIEQELGLTYHADPASLAAAVDIVNLQIPLYPSTEHLFDAAMIARMKRGAYLINTARAKLVDRDAVVRAVTSGHLAGYGGDVWFPQPAPADHPWRAMPFNGMTPHISGTSLSAQARYAAGTLEILQCWFDGRPIRNEYLIVDGGTLAGTGAQSYRLT
Saadet Alpdağtaş et al. (2018) β€” DMSO tolerant NAD(P)H recycler enzyme from a pathogenic bacterium, Burkholderia dolosa PC543: effect of N-/C-terminal His Tag extension on protein solubility and activity
Engineering in Life Sciences  Β· doi:10.1002/elsc.201800036 β†—  Β· Activity - Classical
30 measurements ▼
Database ID
UniParc: UPI00017992AD β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (30 measurements)

30 measurements β€” page 1 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 30 % v/v 100 64 % Digital Continuous 64 mM sodium phosphate buffer 6.2 37Β°C 170 mM Sodium formate CO2 , H+ 1 mM NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 50 % v/v 100 41 % Digital Continuous 64 mM sodium phosphate buffer 6.2 37Β°C 170 mM Sodium formate CO2 , H+ 1 mM NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Isopropanol 50 % v/v 100 0 % Digital Continuous 64 mM sodium phosphate buffer 6.2 37Β°C 170 mM Sodium formate CO2 , H+ 1 mM NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 50 % v/v 100 0 % Digital Continuous 64 mM sodium phosphate buffer 6.2 37Β°C 170 mM Sodium formate CO2 , H+ 1 mM NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Methanol 50 % v/v 100 0 % Digital Continuous 64 mM sodium phosphate buffer 6.2 37Β°C 170 mM Sodium formate CO2 , H+ 1 mM NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 50 % v/v 100 0 % Digital Continuous 64 mM sodium phosphate buffer 6.2 37Β°C 170 mM Sodium formate CO2 , H+ 1 mM NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 40 % v/v 100 119 % Digital Continuous 64 mM sodium phosphate buffer 6.2 37Β°C 170 mM Sodium formate CO2 , H+ 1 mM NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Isopropanol 40 % v/v 100 0 % Digital Continuous 64 mM sodium phosphate buffer 6.2 37Β°C 170 mM Sodium formate CO2 , H+ 1 mM NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 40 % v/v 100 0 % Digital Continuous 64 mM sodium phosphate buffer 6.2 37Β°C 170 mM Sodium formate CO2 , H+ 1 mM NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Methanol 40 % v/v 100 32 % Digital Continuous 64 mM sodium phosphate buffer 6.2 37Β°C 170 mM Sodium formate CO2 , H+ 1 mM NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 40 % v/v 100 0 % Digital Continuous 64 mM sodium phosphate buffer 6.2 37Β°C 170 mM Sodium formate CO2 , H+ 1 mM NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 30 % v/v 100 172 % Digital Continuous 64 mM sodium phosphate buffer 6.2 37Β°C 170 mM Sodium formate CO2 , H+ 1 mM NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Isopropanol 30 % v/v 100 0 % Digital Continuous 64 mM sodium phosphate buffer 6.2 37Β°C 170 mM Sodium formate CO2 , H+ 1 mM NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 30 % v/v 100 0 % Digital Continuous 64 mM sodium phosphate buffer 6.2 37Β°C 170 mM Sodium formate CO2 , H+ 1 mM NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Methanol 30 % v/v 100 51 % Digital Continuous 64 mM sodium phosphate buffer 6.2 37Β°C 170 mM Sodium formate CO2 , H+ 1 mM NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 5 % v/v 100 130 % Digital Continuous 64 mM sodium phosphate buffer 6.2 37Β°C 170 mM Sodium formate CO2 , H+ 1 mM NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20 % v/v 100 158 % Digital Continuous 64 mM sodium phosphate buffer 6.2 37Β°C 170 mM Sodium formate CO2 , H+ 1 mM NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Isopropanol 20 % v/v 100 54 % Digital Continuous 64 mM sodium phosphate buffer 6.2 37Β°C 170 mM Sodium formate CO2 , H+ 1 mM NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 20 % v/v 100 0 % Digital Continuous 64 mM sodium phosphate buffer 6.2 37Β°C 170 mM Sodium formate CO2 , H+ 1 mM NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Methanol 20 % v/v 100 91 % Digital Continuous 64 mM sodium phosphate buffer 6.2 37Β°C 170 mM Sodium formate CO2 , H+ 1 mM NADP+ β€” Classical aqueous control (in %)
β€Ή Prev
1 2
Next β€Ί

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*