Tannase (gene LpTanQA1-5) from Lactobacillus pentosus QA1-5
Enzyme Description
Sequence
MTDTLIFDSDWLTPEQIQLDGKTINYLAAHDIQYVQHPVAAIQRLNVFVPAAYDNGWTANAYPPDTAPIFMPNTVGGYFPGPADDPTRTQWPNNAPTIKQALKRGYVVIAAGLRGHTTVNESGQRVGQAPAFIVDLKAAVRYVKYNQARLPGNVQRIITNGTSAGGATSALMGASGKSKFFEGRFPSLGAARATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWNRSQPVAGSMKNGRPKFESITGTLSANDQSLSADLKRQFCDYLNGLQLHDANGQALTVSPDGTGTFQNYLVQLLTDSAQSALDKGVDIHKYAGFTVTNGKVTGLDLKAYFTSLTRMKAVPAFDQLDLGSLENRLFGDATVLNRHFTSFSQEHTTVPAQLAETELVEPVNPLTYLTGNQSAKIAQHWRIRHGAADRDTSFAIPIILATVLQNQGQDVDFALPWDIPHSGDYDLGELFAWIDGLCQ
Apinun Kanpiengjai et al. (2019)
β Expression and biochemical characterization of a new alkaline tannase from Lactobacillus pentosus
Protein Expression and Purification
Β· doi:10.1016/j.pep.2019.01.005 β
Β· Stability - Incubation
▼
Database ID
UniParc: UPI000D222E21 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (7 measurements)
7 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of the reaction product of rhodanine with Gallic Acid, 520 nm) in aqueous phase | Isoamyl Alcohol | 20 % v/v | 100.0 | 124.5 | % | Direct | Continuous | Incubation: ?, Assay: 100 mM sodium phosphate buffer | Incubation: ?, Assay: 6.5 | Incubation: Room temperature, Assay: 30Β°C | 6.25 mM Methyl gallate | Gallic Acid , Methanol | β | Assay: 600 rpm | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of the reaction product of rhodanine with Gallic Acid, 520 nm) in aqueous phase | Ethanol | 20 % v/v | 100.0 | 121.6 | % | Direct | Continuous | Incubation: ?, Assay: 100 mM sodium phosphate buffer | Incubation: ?, Assay: 6.5 | Incubation: Room temperature, Assay: 30Β°C | 6.25 mM Methyl gallate | Gallic Acid , Methanol | β | Assay: 600 rpm | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of the reaction product of rhodanine with Gallic Acid, 520 nm) in aqueous phase | Isopropanol | 20 % v/v | 100.0 | 125.4 | % | Direct | Continuous | Incubation: ?, Assay: 100 mM sodium phosphate buffer | Incubation: ?, Assay: 6.5 | Incubation: Room temperature, Assay: 30Β°C | 6.25 mM Methyl gallate | Gallic Acid , Methanol | β | Assay: 600 rpm | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of the reaction product of rhodanine with Gallic Acid, 520 nm) in aqueous phase | Methanol | 20 % v/v | 100.0 | 102.1 | % | Direct | Continuous | Incubation: ?, Assay: 100 mM sodium phosphate buffer | Incubation: ?, Assay: 6.5 | Incubation: Room temperature, Assay: 30Β°C | 6.25 mM Methyl gallate | Gallic Acid , Methanol | β | Assay: 600 rpm | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of the reaction product of rhodanine with Gallic Acid, 520 nm) in aqueous phase | n-Hexane | 20 % v/v | 100.0 | 100.1 | % | Direct | Continuous | Incubation: ?, Assay: 100 mM sodium phosphate buffer | Incubation: ?, Assay: 6.5 | Incubation: Room temperature, Assay: 30Β°C | 6.25 mM Methyl gallate | Gallic Acid , Methanol | β | Assay: 600 rpm | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of the reaction product of rhodanine with Gallic Acid, 520 nm) in aqueous phase | Toluene | 20 % v/v | 100.0 | 63.8 | % | Direct | Continuous | Incubation: ?, Assay: 100 mM sodium phosphate buffer | Incubation: ?, Assay: 6.5 | Incubation: Room temperature, Assay: 30Β°C | 6.25 mM Methyl gallate | Gallic Acid , Methanol | β | Assay: 600 rpm | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at room temperature), measured by absorbance spectrophotometry (colorimetric assay, absorbance measurement of the reaction product of rhodanine with Gallic Acid, 520 nm) in aqueous phase | Petroleum Ether | 20 % v/v | 100.0 | 90.1 | % | Direct | Continuous | Incubation: ?, Assay: 100 mM sodium phosphate buffer | Incubation: ?, Assay: 6.5 | Incubation: Room temperature, Assay: 30Β°C | 6.25 mM Methyl gallate | Gallic Acid , Methanol | β | Assay: 600 rpm | Non-incubated control (in %), assay in aqueous phase |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.