Flavin-containing monooxygenase from Nitrincola lacisaponensis

Enzyme Description

Extremophile
Yes "alkaliphilic extremophilic" organism
EC Number

Sequence

Length: 454 amino acids
MNTRVAIIGAGPCGLAQLRAFQSAAAKGAAIPELVCFEKQSDWGGMWNYTWRTGVDEHGEPVHGSMYRYLWSNGPKECLEFADYTFDEHFGRPIGSYPPREVLWDYIKGRVEKAGVRDYIRFNTAVRQVSYDETSGLFSVTVQDHSNNRVYTETFDYVVNACGHFSTPNTPYFEGFERFGGRVLHAHDFRDALEFKDKDILVVGSSYSAEDIGSQCYKYGARSITSCYRSAPMGYQWPQNWEEKPLLQRVDSDTAWFADGSHKRIDAIILCTGYQHHFPFLPDSLRLITENRLWPLKLYKGIFWEDNPKFLYLGMQDQWYSFNMFDAQAWYARDVILGRISLPGKAEMQAENQAWREREEKLQTAQEMFEFQGSYIQHLIDATDYPSFDIQAVNETFLAWKHDKYEDIMGYRNKCYRSLMTGTLATPHHTPWLDALDDSLEAYLQETPRLKSAV
Nikola Lončar et al. (2019) β€” Characterization of a thermostable flavin-containing monooxygenase from Nitrincola lacisaponensis (NiFMO)
Applied Microbiology and Biotechnology  Β· doi:10.1007/s00253-018-09579-w β†—  Β· Activity - Classical Stability - Tm
32 measurements
Database ID
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli NEB10Ξ²

Experimental Data (32 measurements)

32 measurements β€” page 1 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 5 % v/v 1.05 0.5 1/s Digital Continuous 50 mM potassium phosphate buffer 7.5 25Β°C Molecular oxygen, Trimethylamine H2O , Trimethylamine N-oxide β€” β€” Classical aqueous control (in 1/s)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 2.5 % v/v 1.05 0.3 1/s Digital Continuous 50 mM potassium phosphate buffer 7.5 25Β°C Molecular oxygen, Trimethylamine H2O , Trimethylamine N-oxide β€” β€” Classical aqueous control (in 1/s)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 10 % v/v 1.05 0.6 1/s Digital Continuous 50 mM potassium phosphate buffer 7.5 25Β°C Molecular oxygen, Trimethylamine H2O , Trimethylamine N-oxide β€” β€” Classical aqueous control (in 1/s)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 7.5 % v/v 1.05 0.7 1/s Digital Continuous 50 mM potassium phosphate buffer 7.5 25Β°C Molecular oxygen, Trimethylamine H2O , Trimethylamine N-oxide β€” β€” Classical aqueous control (in 1/s)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 5 % v/v 1.05 0.8 1/s Digital Continuous 50 mM potassium phosphate buffer 7.5 25Β°C Molecular oxygen, Trimethylamine H2O , Trimethylamine N-oxide β€” β€” Classical aqueous control (in 1/s)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 2.5 % v/v 1.05 0.8 1/s Digital Continuous 50 mM potassium phosphate buffer 7.5 25Β°C Molecular oxygen, Trimethylamine H2O , Trimethylamine N-oxide β€” β€” Classical aqueous control (in 1/s)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10 % v/v 1.05 0.1 1/s Digital Continuous 50 mM potassium phosphate buffer 7.5 25Β°C Molecular oxygen, Trimethylamine H2O , Trimethylamine N-oxide β€” β€” Classical aqueous control (in 1/s)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 7.5 % v/v 1.05 0.2 1/s Digital Continuous 50 mM potassium phosphate buffer 7.5 25Β°C Molecular oxygen, Trimethylamine H2O , Trimethylamine N-oxide β€” β€” Classical aqueous control (in 1/s)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 5 % v/v 1.05 0.2 1/s Digital Continuous 50 mM potassium phosphate buffer 7.5 25Β°C Molecular oxygen, Trimethylamine H2O , Trimethylamine N-oxide β€” β€” Classical aqueous control (in 1/s)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 2.5 % v/v 1.05 0.3 1/s Digital Continuous 50 mM potassium phosphate buffer 7.5 25Β°C Molecular oxygen, Trimethylamine H2O , Trimethylamine N-oxide β€” β€” Classical aqueous control (in 1/s)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Methanol 10 % v/v 1.05 0.7 1/s Digital Continuous 50 mM potassium phosphate buffer 7.5 25Β°C Molecular oxygen, Trimethylamine H2O , Trimethylamine N-oxide β€” β€” Classical aqueous control (in 1/s)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Methanol 7.5 % v/v 1.05 0.8 1/s Digital Continuous 50 mM potassium phosphate buffer 7.5 25Β°C Molecular oxygen, Trimethylamine H2O , Trimethylamine N-oxide β€” β€” Classical aqueous control (in 1/s)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Methanol 5 % v/v 1.05 0.9 1/s Digital Continuous 50 mM potassium phosphate buffer 7.5 25Β°C Molecular oxygen, Trimethylamine H2O , Trimethylamine N-oxide β€” β€” Classical aqueous control (in 1/s)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Methanol 2.5 % v/v 1.05 0.8 1/s Digital Continuous 50 mM potassium phosphate buffer 7.5 25Β°C Molecular oxygen, Trimethylamine H2O , Trimethylamine N-oxide β€” β€” Classical aqueous control (in 1/s)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 10 % v/v 1.05 0.4 1/s Digital Continuous 50 mM potassium phosphate buffer 7.5 25Β°C Molecular oxygen, Trimethylamine H2O , Trimethylamine N-oxide β€” β€” Classical aqueous control (in 1/s)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 7.5 % v/v 1.05 0.5 1/s Digital Continuous 50 mM potassium phosphate buffer 7.5 25Β°C Molecular oxygen, Trimethylamine H2O , Trimethylamine N-oxide β€” β€” Classical aqueous control (in 1/s)
Stability - Tm Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent Acetonitrile 10 % v/v 51.0 39.3 Β°C Digital Continuous 50 mM potassium phosphate buffer 7.5 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent Acetonitrile 7.5 % v/v 51.0 41.3 Β°C Digital Continuous 50 mM potassium phosphate buffer 7.5 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent Acetonitrile 5 % v/v 51.0 44.5 Β°C Digital Continuous 50 mM potassium phosphate buffer 7.5 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Tm measured by ThermoFAD (detection of FAD fluorescence change upon protein unfolding) in the presence of organic solvent Acetonitrile 2.5 % v/v 51.0 45.5 Β°C Digital Continuous 50 mM potassium phosphate buffer 7.5 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
β€Ή Prev
1 2

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Tm

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*