Esterase (gene EstGtA3) from Geobacillus thermodenitrificans NG80β2
Enzyme Description
Extremophile
Yes
"thermophilic" organism
EC Number
Sequence
MVMAIAAGIMRDYALYSGELQEKIELLVYLPSNFSPLHKYSLLIAQDGKDYFMYGKVKRVIETLMEEGTIDRTIVVGIPYRNVNDRYEKYHPAGQKHEAYIRFLAHELVPFLDHELPTYQMGKGRALIGDSLGGTISLLAGLLYPHTFGNIAMQSPYIDDSVLARIRAFRDPSLLSIYHSVGTEETAVKTTDGHVRDFITPNRVARDLFMEKQFAYTYHEFAGGHAWTYWQPDLPRAVSAILSL
Nicola Curci et al. (2019)
β Identification of a novel esterase from the thermophilic bacterium Geobacillus thermodenitrificans NG80-2
Extremophiles
Β· doi:10.1007/s00792-019-01093-9 β
Β· Stability - Incubation
▼
Database ID
UniProt: A4ILC0 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (20 measurements)
20 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (1 hour at 55Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Chloroform | 10 % v/v | 100 | 51 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM TrisβHCl, 4% propan-2-ol | Incubation: ?, Assay: 7.5 | Incubation: 55Β°C, Assay: 55Β°C | 2 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 55Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethylformamide (DMF) | 30 % v/v | 100 | 60 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM TrisβHCl, 4% propan-2-ol | Incubation: ?, Assay: 7.5 | Incubation: 55Β°C, Assay: 55Β°C | 2 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 55Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethylformamide (DMF) | 10 % v/v | 100 | 49 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM TrisβHCl, 4% propan-2-ol | Incubation: ?, Assay: 7.5 | Incubation: 55Β°C, Assay: 55Β°C | 2 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 55Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetonitrile | 30 % v/v | 100 | 42 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM TrisβHCl, 4% propan-2-ol | Incubation: ?, Assay: 7.5 | Incubation: 55Β°C, Assay: 55Β°C | 2 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 55Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetonitrile | 10 % v/v | 100 | 41 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM TrisβHCl, 4% propan-2-ol | Incubation: ?, Assay: 7.5 | Incubation: 55Β°C, Assay: 55Β°C | 2 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 55Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | 1-Butanol | 30 % v/v | 100 | 42 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM TrisβHCl, 4% propan-2-ol | Incubation: ?, Assay: 7.5 | Incubation: 55Β°C, Assay: 55Β°C | 2 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 55Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | 1-Butanol | 10 % v/v | 100 | 37 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM TrisβHCl, 4% propan-2-ol | Incubation: ?, Assay: 7.5 | Incubation: 55Β°C, Assay: 55Β°C | 2 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 55Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Isopropanol | 30 % v/v | 100 | 53 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM TrisβHCl, 4% propan-2-ol | Incubation: ?, Assay: 7.5 | Incubation: 55Β°C, Assay: 55Β°C | 2 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 55Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Isopropanol | 10 % v/v | 100 | 30 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM TrisβHCl, 4% propan-2-ol | Incubation: ?, Assay: 7.5 | Incubation: 55Β°C, Assay: 55Β°C | 2 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 55Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Chloroform | 30 % v/v | 100 | 34 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM TrisβHCl, 4% propan-2-ol | Incubation: ?, Assay: 7.5 | Incubation: 55Β°C, Assay: 55Β°C | 2 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 55Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 10 % v/v | 100 | 92 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM TrisβHCl, 4% propan-2-ol | Incubation: ?, Assay: 7.5 | Incubation: 55Β°C, Assay: 55Β°C | 2 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 55Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 30 % v/v | 100 | 62 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM TrisβHCl, 4% propan-2-ol | Incubation: ?, Assay: 7.5 | Incubation: 55Β°C, Assay: 55Β°C | 2 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 55Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 10 % v/v | 100 | 93 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM TrisβHCl, 4% propan-2-ol | Incubation: ?, Assay: 7.5 | Incubation: 55Β°C, Assay: 55Β°C | 2 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 55Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetone | 30 % v/v | 100 | 62 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM TrisβHCl, 4% propan-2-ol | Incubation: ?, Assay: 7.5 | Incubation: 55Β°C, Assay: 55Β°C | 2 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 55Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetone | 10 % v/v | 100 | 89 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM TrisβHCl, 4% propan-2-ol | Incubation: ?, Assay: 7.5 | Incubation: 55Β°C, Assay: 55Β°C | 2 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 55Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | n-Hexane | 30 % v/v | 100 | 143 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM TrisβHCl, 4% propan-2-ol | Incubation: ?, Assay: 7.5 | Incubation: 55Β°C, Assay: 55Β°C | 2 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 55Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | n-Hexane | 10 % v/v | 100 | 113 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM TrisβHCl, 4% propan-2-ol | Incubation: ?, Assay: 7.5 | Incubation: 55Β°C, Assay: 55Β°C | 2 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 55Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 30 % v/v | 100 | 40 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM TrisβHCl, 4% propan-2-ol | Incubation: ?, Assay: 7.5 | Incubation: 55Β°C, Assay: 55Β°C | 2 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 55Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 10 % v/v | 100 | 85 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM TrisβHCl, 4% propan-2-ol | Incubation: ?, Assay: 7.5 | Incubation: 55Β°C, Assay: 55Β°C | 2 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 55Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 30 % v/v | 100 | 50 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM TrisβHCl, 4% propan-2-ol | Incubation: ?, Assay: 7.5 | Incubation: 55Β°C, Assay: 55Β°C | 2 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in aqueous phase |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.