Manganese peroxidase (gene MnP2) from Trametes polyzona KU-RNW027
Enzyme Description
Sequence
MAFKTLASFVAVLAALQVANGALTRRVTCPDGVNTASNAACCALFPVLDDIQKNLFDGGQCGEEVHESLRLTFHDAIGISPKIAATGVFGGGGADGSIALFEDIETNFHANNGVDEIIDEQKPFIARHNITTADFIQFAGAIGVSNCPGAPRLDVFVGRKDATQPAPDKTVPEPFDSVDDILARFEDAGGFTAAEVVALLASGTRVAAADHVDPTIPGTPFDSTPERFDTQFFIETQLRGTLFPGTGGNQGEVESPLQGELRLQSDAELARDSRTACEWQSFVNNQAKMQSAFKAAFRKMTVLGHNVNDLVDCSEVVPTPPAPASNAHFPAGLSNKDVEQACSSTPFPTLPTDPGPVTSVAPVPPS
Piyangkun Lueangjaroenkit et al. (2019)
β Two Manganese Peroxidases and a Laccase of Trametes polyzona KU-RNW027 with Novel Properties for Dye and Pharmaceutical Product Degradation in Redox Mediator-Free System
Mycobiology
Β· doi:10.1080/12298093.2019.1589900 β
Β· Stability - Incubation
▼
Database ID
UniProt: A0A2Z5WAA7 β
Sequence Annotation
Inferred - from protein name
Protein Source
Purified, fungus Trametes polyzona KU-RNW027
Experimental Data (30 measurements)
30 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase | Isopropanol | 10 % v/v | 100.0 | 170.5 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM HβOβ (Hydrogen Peroxide), 1mM MnSOβ | Incubation: ?, Assay: 4.5 | Incubation: 4Β°C, Assay: 37Β°C | 1 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase | Acetone | 50 % v/v | 100.0 | 74.0 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM HβOβ (Hydrogen Peroxide), 1mM MnSOβ | Incubation: ?, Assay: 4.5 | Incubation: 4Β°C, Assay: 37Β°C | 1 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase | Acetone | 40 % v/v | 100.0 | 97.5 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM HβOβ (Hydrogen Peroxide), 1mM MnSOβ | Incubation: ?, Assay: 4.5 | Incubation: 4Β°C, Assay: 37Β°C | 1 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase | Acetone | 30 % v/v | 100.0 | 120.0 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM HβOβ (Hydrogen Peroxide), 1mM MnSOβ | Incubation: ?, Assay: 4.5 | Incubation: 4Β°C, Assay: 37Β°C | 1 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase | Acetone | 20 % v/v | 100.0 | 131.5 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM HβOβ (Hydrogen Peroxide), 1mM MnSOβ | Incubation: ?, Assay: 4.5 | Incubation: 4Β°C, Assay: 37Β°C | 1 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase | Acetone | 10 % v/v | 100.0 | 171.5 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM HβOβ (Hydrogen Peroxide), 1mM MnSOβ | Incubation: ?, Assay: 4.5 | Incubation: 4Β°C, Assay: 37Β°C | 1 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase | 1-Butanol | 50 % v/v | 100.0 | 201.5 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM HβOβ (Hydrogen Peroxide), 1mM MnSOβ | Incubation: ?, Assay: 4.5 | Incubation: 4Β°C, Assay: 37Β°C | 1 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase | 1-Butanol | 40 % v/v | 100.0 | 206.5 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM HβOβ (Hydrogen Peroxide), 1mM MnSOβ | Incubation: ?, Assay: 4.5 | Incubation: 4Β°C, Assay: 37Β°C | 1 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase | 1-Butanol | 30 % v/v | 100.0 | 215.5 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM HβOβ (Hydrogen Peroxide), 1mM MnSOβ | Incubation: ?, Assay: 4.5 | Incubation: 4Β°C, Assay: 37Β°C | 1 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase | 1-Butanol | 20 % v/v | 100.0 | 226.0 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM HβOβ (Hydrogen Peroxide), 1mM MnSOβ | Incubation: ?, Assay: 4.5 | Incubation: 4Β°C, Assay: 37Β°C | 1 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase | 1-Butanol | 10 % v/v | 100.0 | 212.5 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM HβOβ (Hydrogen Peroxide), 1mM MnSOβ | Incubation: ?, Assay: 4.5 | Incubation: 4Β°C, Assay: 37Β°C | 1 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase | Isopropanol | 50 % v/v | 100.0 | 39.5 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM HβOβ (Hydrogen Peroxide), 1mM MnSOβ | Incubation: ?, Assay: 4.5 | Incubation: 4Β°C, Assay: 37Β°C | 1 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase | Isopropanol | 40 % v/v | 100.0 | 43.0 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM HβOβ (Hydrogen Peroxide), 1mM MnSOβ | Incubation: ?, Assay: 4.5 | Incubation: 4Β°C, Assay: 37Β°C | 1 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase | Isopropanol | 30 % v/v | 100.0 | 57.0 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM HβOβ (Hydrogen Peroxide), 1mM MnSOβ | Incubation: ?, Assay: 4.5 | Incubation: 4Β°C, Assay: 37Β°C | 1 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase | Isopropanol | 20 % v/v | 100.0 | 131.0 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM HβOβ (Hydrogen Peroxide), 1mM MnSOβ | Incubation: ?, Assay: 4.5 | Incubation: 4Β°C, Assay: 37Β°C | 1 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase | Methanol | 10 % v/v | 100.0 | 161.0 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM HβOβ (Hydrogen Peroxide), 1mM MnSOβ | Incubation: ?, Assay: 4.5 | Incubation: 4Β°C, Assay: 37Β°C | 1 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase | 1-Propanol | 50 % v/v | 100.0 | 48.0 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM HβOβ (Hydrogen Peroxide), 1mM MnSOβ | Incubation: ?, Assay: 4.5 | Incubation: 4Β°C, Assay: 37Β°C | 1 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase | 1-Propanol | 40 % v/v | 100.0 | 49.5 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM HβOβ (Hydrogen Peroxide), 1mM MnSOβ | Incubation: ?, Assay: 4.5 | Incubation: 4Β°C, Assay: 37Β°C | 1 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase | 1-Propanol | 30 % v/v | 100.0 | 61.0 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM HβOβ (Hydrogen Peroxide), 1mM MnSOβ | Incubation: ?, Assay: 4.5 | Incubation: 4Β°C, Assay: 37Β°C | 1 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (2.6 dimethoxyphenol radical cation reaction products absorbance measurement, 469 nm) in aqueous phase | 1-Propanol | 20 % v/v | 100.0 | 104.5 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM malonate buffer, 0.2 MM HβOβ (Hydrogen Peroxide), 1mM MnSOβ | Incubation: ?, Assay: 4.5 | Incubation: 4Β°C, Assay: 37Β°C | 1 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.