Azoreductase (gene AzoRed2) from Streptomyces sp. S27

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 233 amino acids
VPRLLHLDSSARTDSFTRRLGAAFVRAWRLNGGGEVTHRDLAIDPPPPISEGWTSLCDTLLREGITEAATDHYAQAVRTEAERRAWAVTEPLLAELLAADVVLIGAPMYNFGVPAALKAWIDQVTFPKMVLAPRRFVVLSARGGAYGPGTPREPFDHQGRYLLDFFHGHYGVEDAEVISAELVNSLSDPGLAGRLPQHLDSAAAALARAVELGTELATVPATTSADRTLAKEG
Hao Dong et al. (2019) β€” Biochemical characterization of a novel azoreductase from Streptomyces sp.: Application in eco-friendly decolorization of azo dye wastewater
International Journal of Biological Macromolecules  Β· doi:10.1016/j.ijbiomac.2019.08.196 β†—  Β· Stability - Incubation
22 measurements
Database ID
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (22 measurements)

22 measurements β€” page 2 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase Ethanol 10 % v/v 100.0 91.41 % Direct Continuous Incubation: ?, Assay: 25 mM Tris-HCl buffer Incubation: ?, Assay: 7.4 Incubation: 30Β°C, Assay: 30Β°C 25 Β΅M Methyl red N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid 250 Β΅M NADH, 5 Β΅M FMN Incubation: 80 rpm Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase Methanol 10 % v/v 100.0 80.98 % Direct Continuous Incubation: ?, Assay: 25 mM Tris-HCl buffer Incubation: ?, Assay: 7.4 Incubation: 30Β°C, Assay: 30Β°C 25 Β΅M Methyl red N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid 250 Β΅M NADH, 5 Β΅M FMN Incubation: 80 rpm Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents
1 2
Next β€Ί

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*