Pyruvate decarboxylase from Zymobacter palmae
Enzyme Description
Sequence
MYTVGMYLAERLAQIGLKHHFAVAGDYNLVLLDQLLLNKDMEQVYCCNELNCGFSAEGYARARGAAAAIVTFSVGAISAMNAIGGAYAENLPVILISGSPNTNDYGTGHILHHTIGTTDYNYQLEMVKHVTCARESIVSAEEAPAKIDHVIRTALRERKPAYLEIACNVAGAECVRPGPINSLLRELEVDQTSVTAAVDAAVEWLQDRQNVVMLVGSKLRAAAAEKQAVALADRLGCAVTIMAAEKGFFPEDHPNFRGLYWGEVSSEGAQELVENADAILCLAPVFNDYATVGWNSWPKGDNVMVMDTDRVTFAGQSFEGLSLSTFAAALAEKAPSRPATTQGTQAPVLGIEAAEPNAPLTNDEMTRQIQSLITSDTTLTAETGDSWFNASRMPIPGGARVELEMQWGHIGWSVPSAFGNAVGSPERRHIMMVGDGSFQLTAQEVAQMIRYEIPVIIFLINNRGYVIEIAIHDGPYNYIKNWNYAGLIDVFNDEDGHGLGLKASTGAELEGAIKKALDNRRGPTLIECNIAQDDCTETLIAWGKRVAATNSRKPQA
Samuel Sutiono et al. (2019)
β To beat the heatβengineering of the most thermostable pyruvate decarboxylase to date
RSC Advances
Β· doi:10.1039/c9ra06251c β
Β· Stability - Incubation
▼
Database ID
UniProt: Q8KTX6 β
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (8 measurements)
8 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (change in pyruvate absorbance measurement, 315 nm) in aqueous phase | Ethanol | 4 % v/v | 100 | 98 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 6.5, Assay: 6.5 | Incubation: 50Β°C, Assay: 25Β°C | 25 mM Pyruvate | Acetaldehyde , Carbon Dioxide (CO2) | Incubation: 0.1 mM TDP, 5 mM MgSOβ, Assay: 0.1 mM TDP, 5 mM MgSOβ | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous conditions/Explicit protein sequence given corresponds to UniProt A0A4Y3TS39 which is annotated as for a protein from Acetobacter peroxydans |
| Stability - Incubation | Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (change in pyruvate absorbance measurement, 315 nm) in aqueous phase | Ethanol | 8 % v/v | 100 | 94 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 6.5, Assay: 6.5 | Incubation: 50Β°C, Assay: 25Β°C | 25 mM Pyruvate | Acetaldehyde , Carbon Dioxide (CO2) | Incubation: 0.1 mM TDP, 5 mM MgSOβ, Assay: 0.1 mM TDP, 5 mM MgSOβ | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous conditions/Explicit protein sequence given corresponds to UniProt A0A4Y3TS39 which is annotated as for a protein from Acetobacter peroxydans |
| Stability - Incubation | Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (change in pyruvate absorbance measurement, 315 nm) in aqueous phase | Ethanol | 12 % v/v | 100 | 87 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 6.5, Assay: 6.5 | Incubation: 50Β°C, Assay: 25Β°C | 25 mM Pyruvate | Acetaldehyde , Carbon Dioxide (CO2) | Incubation: 0.1 mM TDP, 5 mM MgSOβ, Assay: 0.1 mM TDP, 5 mM MgSOβ | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous conditions/Explicit protein sequence given corresponds to UniProt A0A4Y3TS39 which is annotated as for a protein from Acetobacter peroxydans |
| Stability - Incubation | Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (change in pyruvate absorbance measurement, 315 nm) in aqueous phase | Ethanol | 16 % v/v | 100 | 66 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 6.5, Assay: 6.5 | Incubation: 50Β°C, Assay: 25Β°C | 25 mM Pyruvate | Acetaldehyde , Carbon Dioxide (CO2) | Incubation: 0.1 mM TDP, 5 mM MgSOβ, Assay: 0.1 mM TDP, 5 mM MgSOβ | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous conditions/Explicit protein sequence given corresponds to UniProt A0A4Y3TS39 which is annotated as for a protein from Acetobacter peroxydans |
| Stability - Incubation | Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (change in pyruvate absorbance measurement, 315 nm) in aqueous phase | Ethanol | 20 % v/v | 100 | 15 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 6.5, Assay: 6.5 | Incubation: 50Β°C, Assay: 25Β°C | 25 mM Pyruvate | Acetaldehyde , Carbon Dioxide (CO2) | Incubation: 0.1 mM TDP, 5 mM MgSOβ, Assay: 0.1 mM TDP, 5 mM MgSOβ | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous conditions/Explicit protein sequence given corresponds to UniProt A0A4Y3TS39 which is annotated as for a protein from Acetobacter peroxydans |
| Stability - Incubation | Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (change in pyruvate absorbance measurement, 315 nm) in aqueous phase | Ethanol | 24 % v/v | 100 | 10 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 6.5, Assay: 6.5 | Incubation: 50Β°C, Assay: 25Β°C | 25 mM Pyruvate | Acetaldehyde , Carbon Dioxide (CO2) | Incubation: 0.1 mM TDP, 5 mM MgSOβ, Assay: 0.1 mM TDP, 5 mM MgSOβ | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous conditions/Explicit protein sequence given corresponds to UniProt A0A4Y3TS39 which is annotated as for a protein from Acetobacter peroxydans |
| Stability - Incubation | Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (change in pyruvate absorbance measurement, 315 nm) in aqueous phase | Ethanol | 28 % v/v | 100 | 10 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 6.5, Assay: 6.5 | Incubation: 50Β°C, Assay: 25Β°C | 25 mM Pyruvate | Acetaldehyde , Carbon Dioxide (CO2) | Incubation: 0.1 mM TDP, 5 mM MgSOβ, Assay: 0.1 mM TDP, 5 mM MgSOβ | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous conditions/Explicit protein sequence given corresponds to UniProt A0A4Y3TS39 which is annotated as for a protein from Acetobacter peroxydans |
| Stability - Incubation | Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (change in pyruvate absorbance measurement, 315 nm) in aqueous phase | Ethanol | 32 % v/v | 100 | 5 | % | Digital | Continuous | Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer | Incubation: 6.5, Assay: 6.5 | Incubation: 50Β°C, Assay: 25Β°C | 25 mM Pyruvate | Acetaldehyde , Carbon Dioxide (CO2) | Incubation: 0.1 mM TDP, 5 mM MgSOβ, Assay: 0.1 mM TDP, 5 mM MgSOβ | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous conditions/Explicit protein sequence given corresponds to UniProt A0A4Y3TS39 which is annotated as for a protein from Acetobacter peroxydans |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume. β β β Reference value. Hover for details.