Carboxylesterase (gene BaCEs04) from Bacillus velezensis SYBC H47
Enzyme Description
Species
Extremophile
No
but thermophilic enzyme
EC Number
Sequence
MDGKQINRGFAPAGRYAVPGTEVREMRSKGGRTFRIFVSFPQEEPPASGFPVIYLLDANSVFGTMAEALRVQSRRPEKTGVVPAVIVGIGYPTDQPFSAERHSDFTMPLSESELPVHPRGAAWPEQGGAEAFLEFIEEEVKPAMERDYPIDRGRQTIFGHSLGGLFVLQVLLTRPDMFQTYVAGSPSIHWNKRFIQENAERLSDRLSAENLQVSVLLAAGEIEKTHKSRIPQHAEALYALLSGFEGDGVRAEYSEFEGEGHISVLPVLISRALRFCLNPGGPHTPYSPA
Lin Huang et al. (2020)
β Characterization of a novel carboxylesterase from Bacillus velezensis SYBC H47 and its application in degradation of phthalate esters
Journal of Bioscience and Bioengineering
Β· doi:10.1016/j.jbiosc.2019.11.002 β
Β· Stability - Incubation
▼
Database ID
UniProt: A0A5C1ZXA0 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (6 measurements)
6 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (1 hour at 37Β°C), measured by absorbance spectrophotometry (Ξ²-naphtol absorbance measurement, 555 nm) in aqueous phase | Ethanol | 10 % v/v | 100.0 | 93.64 | % | Direct | Continuous | Incubation: 50 mM potassium phosphate, Assay: 50 mM potassium phosphate | Incubation: 7, Assay: 7 | Incubation: 37Β°C, Assay: 37Β°C | 600 mM 2-Naphthyl acetate | Acetate , beta-naphtol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about assay buffer and pH |
| Stability - Incubation | Activity after incubation (1 hour at 37Β°C), measured by absorbance spectrophotometry (Ξ²-naphtol absorbance measurement, 555 nm) in aqueous phase | Methanol | 10 % v/v | 100.0 | 85.81 | % | Direct | Continuous | Incubation: 50 mM potassium phosphate, Assay: 50 mM potassium phosphate | Incubation: 7, Assay: 7 | Incubation: 37Β°C, Assay: 37Β°C | 600 mM 2-Naphthyl acetate | Acetate , beta-naphtol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about assay buffer and pH |
| Stability - Incubation | Activity after incubation (1 hour at 37Β°C), measured by absorbance spectrophotometry (Ξ²-naphtol absorbance measurement, 555 nm) in aqueous phase | Isopropanol | 10 % v/v | 100.0 | 126.9 | % | Direct | Continuous | Incubation: 50 mM potassium phosphate, Assay: 50 mM potassium phosphate | Incubation: 7, Assay: 7 | Incubation: 37Β°C, Assay: 37Β°C | 600 mM 2-Naphthyl acetate | Acetate , beta-naphtol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about assay buffer and pH |
| Stability - Incubation | Activity after incubation (1 hour at 37Β°C), measured by absorbance spectrophotometry (Ξ²-naphtol absorbance measurement, 555 nm) in aqueous phase | Acetone | 10 % v/v | 100.0 | 122.32 | % | Direct | Continuous | Incubation: 50 mM potassium phosphate, Assay: 50 mM potassium phosphate | Incubation: 7, Assay: 7 | Incubation: 37Β°C, Assay: 37Β°C | 600 mM 2-Naphthyl acetate | Acetate , beta-naphtol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about assay buffer and pH |
| Stability - Incubation | Activity after incubation (1 hour at 37Β°C), measured by absorbance spectrophotometry (Ξ²-naphtol absorbance measurement, 555 nm) in aqueous phase | n-Hexane | 10 % v/v | 100.0 | 130.23 | % | Direct | Continuous | Incubation: 50 mM potassium phosphate, Assay: 50 mM potassium phosphate | Incubation: 7, Assay: 7 | Incubation: 37Β°C, Assay: 37Β°C | 600 mM 2-Naphthyl acetate | Acetate , beta-naphtol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about assay buffer and pH |
| Stability - Incubation | Activity after incubation (1 hour at 37Β°C), measured by absorbance spectrophotometry (Ξ²-naphtol absorbance measurement, 555 nm) in aqueous phase | Acetonitrile | 10 % v/v | 100.0 | 82.85 | % | Direct | Continuous | Incubation: 50 mM potassium phosphate, Assay: 50 mM potassium phosphate | Incubation: 7, Assay: 7 | Incubation: 37Β°C, Assay: 37Β°C | 600 mM 2-Naphthyl acetate | Acetate , beta-naphtol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about assay buffer and pH |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.