N-terminal truncated (20 residues) esterase (gene estA1) from Alteromonas sp. 39-G1

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 359 amino acids
ASTSGASTHNTDTASASKQKADTVKISNESPLTVPAKTLPLPSASSDELKSAISQYPMPSVDEVINNTPQSIEQWRELIQIRNADQKKKIKKMRKQFDVDVSLEKINGVPVRRLTPKTIAPEFKNKVFIDVHGGAYVFFSGLPSIEESLLIAHRVGITVISIDYSMPPHAPFPAALNDVVSVYSSVAAEHGAQNLFIGGTSAGAGLVLAAVQTLIADKQPLPAAVYAGTPWADLTKTGDTLYTNEGVDRILVTYQGFLEAAANLYAGSESLTHSSISPLYGNFDGFPPTFLISGTRDMFLSDTVRVNRKLRDAQVRTQLEVFEGLSHADYVVAYETPESHSVYQELKQFLLSVCTKSSD
Seok-Jae Won et al. (2020) β€” Characterization of Novel Salt-Tolerant Esterase Isolated from the Marine Bacterium Alteromonas sp. 39-G1
Journal of Microbiology and Biotechnology  Β· doi:10.4014/jmb.1907.07057 β†—  Β· Stability - Incubation
24 measurements
Database ID
Sequence Annotation
Explicit (20 first residues deleted)
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (24 measurements)

24 measurements β€” page 2 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetone 15 % v/v 100 108 % Direct Continuous Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 40Β°C 0.1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 15 % v/v 100 87 % Direct Continuous Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 40Β°C 0.1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetonitrile 15 % v/v 100 68 % Direct Continuous Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 40Β°C 0.1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 15 % v/v 100 100 % Direct Continuous Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 40Β°C 0.1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
1 2
Next β€Ί

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*