Serine protease 1 (gene baapr1) from Bacillus altitudinis W3
Enzyme Description
Species
Extremophile
No
but "alkaline-stable" enzyme
EC Number
Sequence
MCVKKKNVMTSVLLAVPLLFSAGFGGSIANAETASKSESEKSYIVGFKASATTNSSKKQAVTQNGGKLEKQYRLINAAQVKMSEQAAKKLEHDPSIAYVEEDHKAEAYAQTVPYGIPQIKAPAVHAQGYKGANVKVAVLDTGIHAAHPDLNVAGGASFVPSEPNATQDFQSHGTHVAGTIAALDNTIGVLGVAPSASLYAVKVLDRYGDGQYSWIISGIEWAVANNMDVINMSLGGPNGSTALKNAVDTANNRGVVVVAAAGNSGSTGSTSTVGYPAKYDSTIAVANVNSNNVRNSSSSAGPELDVSAPGTSILSTVPSSGYTSYTGTSMASPHVAGAAALILSKYPNLSTSQVRQRLENTATPLGNSFYYGKGLINVQAASN
Shaolan Yang et al. (2020)
β Mining of alkaline proteases from Bacillus altitudinis W3 for desensitization of milk proteins: Their heterologous expression, purification, and characterization
International Journal of Biological Macromolecules
Β· doi:10.1016/j.ijbiomac.2019.10.252 β
Β· Stability - Incubation
▼
Database ID
UniProt: A0A6G6A9P9 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Bacillus subtilis WB600
Experimental Data (9 measurements)
9 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 0.5 % v/v | 100 | 110 | % | Digital | Continuous | Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2 | Incubation: 9.5, Assay: 10 | Incubation: 25Β°C, Assay: 50Β°C | 2 g/L Azocasein | Azo-peptides , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase | Methanol | 5 % v/v | 100 | 79 | % | Digital | Continuous | Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2 | Incubation: 9.5, Assay: 10 | Incubation: 25Β°C, Assay: 50Β°C | 2 g/L Azocasein | Azo-peptides , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase | Ethanol | 5 % v/v | 100 | 70 | % | Digital | Continuous | Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2 | Incubation: 9.5, Assay: 10 | Incubation: 25Β°C, Assay: 50Β°C | 2 g/L Azocasein | Azo-peptides , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase | Isopropanol | 5 % v/v | 100 | 59 | % | Digital | Continuous | Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2 | Incubation: 9.5, Assay: 10 | Incubation: 25Β°C, Assay: 50Β°C | 2 g/L Azocasein | Azo-peptides , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase | Acetone | 5 % v/v | 100 | 72 | % | Digital | Continuous | Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2 | Incubation: 9.5, Assay: 10 | Incubation: 25Β°C, Assay: 50Β°C | 2 g/L Azocasein | Azo-peptides , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase | Acetonitrile | 5 % v/v | 100 | 60 | % | Digital | Continuous | Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2 | Incubation: 9.5, Assay: 10 | Incubation: 25Β°C, Assay: 50Β°C | 2 g/L Azocasein | Azo-peptides , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase | Dichloromethane | 5 % v/v | 100 | 46 | % | Digital | Continuous | Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2 | Incubation: 9.5, Assay: 10 | Incubation: 25Β°C, Assay: 50Β°C | 2 g/L Azocasein | Azo-peptides , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase | n-Hexane | 5 % v/v | 100 | 96 | % | Digital | Continuous | Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2 | Incubation: 9.5, Assay: 10 | Incubation: 25Β°C, Assay: 50Β°C | 2 g/L Azocasein | Azo-peptides , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase | Ethyl Acetate | 5 % v/v | 100 | 43 | % | Digital | Continuous | Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2 | Incubation: 9.5, Assay: 10 | Incubation: 25Β°C, Assay: 50Β°C | 2 g/L Azocasein | Azo-peptides , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.