Serine protease 2 (gene baapr2) from Bacillus altitudinis W3

Enzyme Description

Extremophile
No but "alkaline-stable" enzyme
EC Number

Sequence

Length: 376 amino acids
MKVKSFGAGLCMASMLLASMTFGASDVSAKDQAKKEYMIGFSSSVQDKTQKQLVEKAGGHVKESIEKIDMMKVSLNEASKEKLHQAKEVTFIEEDQKAKTSGQSVPYGIKSIKAQKVHKRGYAGQNVKVAVLDSGIDGKHEDLHVTGGVSFVPTESDPLVDPHEHGTHVAGTIAALDNKVGVVGVAPKASIYAVKVADENGDGYYSWIIKGIEWAIENEMDVINISMGGASESEALKEAVDRAYDNGILIVASAGNAGSYGSLNTIDYPAKYSSVMAVASVDQRKQRAFDSSVGEEVEVSAPGVSTLSTIPHNEYGYKSGTSMASPHVAGAAAVILSKHPNLTNDELRERLTKTATKLGEPFYYGAGLVNVQKAAR
Shaolan Yang et al. (2020) β€” Mining of alkaline proteases from Bacillus altitudinis W3 for desensitization of milk proteins: Their heterologous expression, purification, and characterization
International Journal of Biological Macromolecules  Β· doi:10.1016/j.ijbiomac.2019.10.252 β†—  Β· Stability - Incubation
9 measurements
Database ID
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Bacillus subtilis WB600

Experimental Data (9 measurements)

9 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 0.5 % v/v 100 98 % Digital Continuous Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2 Incubation: 8.5, Assay: 10 Incubation: 25Β°C, Assay: 50Β°C 2 g/L Azocasein Azo-peptides , Peptides β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase Methanol 5 % v/v 100 98 % Digital Continuous Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2 Incubation: 8.5, Assay: 10 Incubation: 25Β°C, Assay: 50Β°C 2 g/L Azocasein Azo-peptides , Peptides β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase Ethanol 5 % v/v 100 81 % Digital Continuous Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2 Incubation: 8.5, Assay: 10 Incubation: 25Β°C, Assay: 50Β°C 2 g/L Azocasein Azo-peptides , Peptides β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase Isopropanol 5 % v/v 100 74 % Digital Continuous Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2 Incubation: 8.5, Assay: 10 Incubation: 25Β°C, Assay: 50Β°C 2 g/L Azocasein Azo-peptides , Peptides β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase Acetone 5 % v/v 100 93 % Digital Continuous Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2 Incubation: 8.5, Assay: 10 Incubation: 25Β°C, Assay: 50Β°C 2 g/L Azocasein Azo-peptides , Peptides β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase Acetonitrile 5 % v/v 100 73 % Digital Continuous Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2 Incubation: 8.5, Assay: 10 Incubation: 25Β°C, Assay: 50Β°C 2 g/L Azocasein Azo-peptides , Peptides β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase Dichloromethane 5 % v/v 100 35 % Digital Continuous Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2 Incubation: 8.5, Assay: 10 Incubation: 25Β°C, Assay: 50Β°C 2 g/L Azocasein Azo-peptides , Peptides β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase n-Hexane 5 % v/v 100 103 % Digital Continuous Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2 Incubation: 8.5, Assay: 10 Incubation: 25Β°C, Assay: 50Β°C 2 g/L Azocasein Azo-peptides , Peptides β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (colorimetric assay, change in Azo-peptides absorbance measurement, 440 nm) in aqueous phase Ethyl Acetate 5 % v/v 100 66 % Digital Continuous Incubation: 50 mM glycine-NaOH buffer, Assay: 50 mM glycine-NaOH buffer, 2 mM CaCl2 Incubation: 8.5, Assay: 10 Incubation: 25Β°C, Assay: 50Β°C 2 g/L Azocasein Azo-peptides , Peptides β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*