Esterase (gene est906) from a paper mill wastewater sediment metagenomic library
Enzyme Description
Species
Na (paper mill wastewater sediment metagenomic library)
Extremophile
No
EC Number
Sequence
MKKSVLVFAFLVSLFTGSVMAQSKRVAASAGRSEYIEVEKNVRLHVTDLGEGQPIVLIHGWPLSDAMYEYQYQYLSRKGFRVIGITLRGFGQSDKPYGKYDFDVFSDDIKVVLEKLNIQNAVLGGFSMGGAVVIHYVTKYNAAHISKLALFGAAAPSWKQRDGSPYGISDADAEGLIKATMTSRQDLIAGFGAAFPAKEGAISKNVEKWLENINLQAWPYASTESITALRDLDLRPSLSKIKIPTVIFHGTQDKLCPFVFAEQLQKGINNSYIVKFENSGHALFVEEADKFNTELEKFAKQ
Xiao-Lin Zhong et al. (2020)
β Characterization and purification via nucleic acid aptamers of a novel esterase from the metagenome of paper mill wastewater sediments
International Journal of Biological Macromolecules
Β· doi:10.1016/j.ijbiomac.2020.02.319 β
Β· Stability - Incubation
▼
Database ID
UniParc: UPI00118AC712 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (15 measurements)
15 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (20 minutes at 54Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetonitrile | 1 % v/v | 100.0 | 98.1 | % | Direct | Continuous | Incubation: 40 mM Britton-Robinson buffer, Assay: 40 mM Britton-Robinson buffer | Incubation: 9.5, Assay: 7.8 | Incubation: 54Β°C, Assay: 45Β°C | 50 mM p-Nitrophenyl hexanoate | caproic acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (20 minutes at 54Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetonitrile | 15 % v/v | 100.0 | 93.6 | % | Direct | Continuous | Incubation: 40 mM Britton-Robinson buffer, Assay: 40 mM Britton-Robinson buffer | Incubation: 9.5, Assay: 7.8 | Incubation: 54Β°C, Assay: 45Β°C | 50 mM p-Nitrophenyl hexanoate | caproic acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (20 minutes at 54Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetonitrile | 30 % v/v | 100.0 | 39.0 | % | Direct | Continuous | Incubation: 40 mM Britton-Robinson buffer, Assay: 40 mM Britton-Robinson buffer | Incubation: 9.5, Assay: 7.8 | Incubation: 54Β°C, Assay: 45Β°C | 50 mM p-Nitrophenyl hexanoate | caproic acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (20 minutes at 54Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 1 % v/v | 100.0 | 122.2 | % | Direct | Continuous | Incubation: 40 mM Britton-Robinson buffer, Assay: 40 mM Britton-Robinson buffer | Incubation: 9.5, Assay: 7.8 | Incubation: 54Β°C, Assay: 45Β°C | 50 mM p-Nitrophenyl hexanoate | caproic acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (20 minutes at 54Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 15 % v/v | 100.0 | 156.9 | % | Direct | Continuous | Incubation: 40 mM Britton-Robinson buffer, Assay: 40 mM Britton-Robinson buffer | Incubation: 9.5, Assay: 7.8 | Incubation: 54Β°C, Assay: 45Β°C | 50 mM p-Nitrophenyl hexanoate | caproic acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (20 minutes at 54Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 30 % v/v | 100.0 | 134.7 | % | Direct | Continuous | Incubation: 40 mM Britton-Robinson buffer, Assay: 40 mM Britton-Robinson buffer | Incubation: 9.5, Assay: 7.8 | Incubation: 54Β°C, Assay: 45Β°C | 50 mM p-Nitrophenyl hexanoate | caproic acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (20 minutes at 54Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 1 % v/v | 100.0 | 117.4 | % | Direct | Continuous | Incubation: 40 mM Britton-Robinson buffer, Assay: 40 mM Britton-Robinson buffer | Incubation: 9.5, Assay: 7.8 | Incubation: 54Β°C, Assay: 45Β°C | 50 mM p-Nitrophenyl hexanoate | caproic acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (20 minutes at 54Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 15 % v/v | 100.0 | 128.4 | % | Direct | Continuous | Incubation: 40 mM Britton-Robinson buffer, Assay: 40 mM Britton-Robinson buffer | Incubation: 9.5, Assay: 7.8 | Incubation: 54Β°C, Assay: 45Β°C | 50 mM p-Nitrophenyl hexanoate | caproic acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (20 minutes at 54Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 30 % v/v | 100.0 | 100.2 | % | Direct | Continuous | Incubation: 40 mM Britton-Robinson buffer, Assay: 40 mM Britton-Robinson buffer | Incubation: 9.5, Assay: 7.8 | Incubation: 54Β°C, Assay: 45Β°C | 50 mM p-Nitrophenyl hexanoate | caproic acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (20 minutes at 54Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Isopropanol | 1 % v/v | 100.0 | 119.8 | % | Direct | Continuous | Incubation: 40 mM Britton-Robinson buffer, Assay: 40 mM Britton-Robinson buffer | Incubation: 9.5, Assay: 7.8 | Incubation: 54Β°C, Assay: 45Β°C | 50 mM p-Nitrophenyl hexanoate | caproic acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (20 minutes at 54Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Isopropanol | 15 % v/v | 100.0 | 120.8 | % | Direct | Continuous | Incubation: 40 mM Britton-Robinson buffer, Assay: 40 mM Britton-Robinson buffer | Incubation: 9.5, Assay: 7.8 | Incubation: 54Β°C, Assay: 45Β°C | 50 mM p-Nitrophenyl hexanoate | caproic acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (20 minutes at 54Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Isopropanol | 30 % v/v | 100.0 | 74.9 | % | Direct | Continuous | Incubation: 40 mM Britton-Robinson buffer, Assay: 40 mM Britton-Robinson buffer | Incubation: 9.5, Assay: 7.8 | Incubation: 54Β°C, Assay: 45Β°C | 50 mM p-Nitrophenyl hexanoate | caproic acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (20 minutes at 54Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 1 % v/v | 100.0 | 89.3 | % | Direct | Continuous | Incubation: 40 mM Britton-Robinson buffer, Assay: 40 mM Britton-Robinson buffer | Incubation: 9.5, Assay: 7.8 | Incubation: 54Β°C, Assay: 45Β°C | 50 mM p-Nitrophenyl hexanoate | caproic acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (20 minutes at 54Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 15 % v/v | 100.0 | 98.0 | % | Direct | Continuous | Incubation: 40 mM Britton-Robinson buffer, Assay: 40 mM Britton-Robinson buffer | Incubation: 9.5, Assay: 7.8 | Incubation: 54Β°C, Assay: 45Β°C | 50 mM p-Nitrophenyl hexanoate | caproic acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (20 minutes at 54Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 30 % v/v | 100.0 | 51.4 | % | Direct | Continuous | Incubation: 40 mM Britton-Robinson buffer, Assay: 40 mM Britton-Robinson buffer | Incubation: 9.5, Assay: 7.8 | Incubation: 54Β°C, Assay: 45Β°C | 50 mM p-Nitrophenyl hexanoate | caproic acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.