Laccase (gene mco) from Staphylococcus haemolyticus
Enzyme Description
Sequence
MYNKVFTILIIIFSIIIIASNDTFAESKNDMMNMKEDKKNTMDMTNMKHHDERKKLNSSQGKNEIIFPEVAESKKDNNGYKNYTLKAQKGKTEFYKNNFSNTLGYNGNLLGPTLKLKKGDKVKIKLINNLDENTTFHWHGLEVNGKVDGGPSQVIKPGKEKTIKFEVNQDSATLWYHPHPSPNTAKQVYNGLSGLLYIEDSKKNNYPSNYGKNDLPIIIQDKTFVSKKLNYSKTKDEDGTQGDTVLVNGIVNPKLTAKEEKIRLRLLNGSNARDLNLKLSNNQSFEYIASDGGQLKNAKKLKEINLAPSERKEIVIDLSKMKGEKVSLVDNDKTVILPISNKEKSSNKSNTPKVSKKIKLEGMNDNVTINGNKFDPNRIDFTQKLNQKEVWEIENVKDKMGGMKHPFHIHGTQFKVLSVDGEKPPKDMRGKKDVISLEPGQKAKIEVVFKNTGTYMFHCHILEHEDNGMMGQIKVTN
Xingxing Li et al. (2020)
β Multiple Tolerance and Dye Decolorization Ability of a Novel Laccase Identified from Staphylococcus Haemolyticus
Journal of Microbiology and Biotechnology
Β· doi:10.4014/jmb.1910.10061 β
Β· Stability - Incubation
▼
Database ID
UniProt: L7SV51 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21
Experimental Data (8 measurements)
8 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (15 minutes at 30Β°C), measured by absorbance spectrophotometry (ABTS absorbance measurement, 420 nm) in aqueous phase | Ethanol | 30 % v/v | 100 | 21 | % | Digital | Continuous | Incubation: 100 mM sodium acetate buffer, Assay: 100 mM sodium acetate buffer | Incubation: 4.5, Assay: 4.5 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM ABTS | ABTS radical cation | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (15 minutes at 30Β°C), measured by absorbance spectrophotometry (ABTS absorbance measurement, 420 nm) in aqueous phase | Ethanol | 10 % v/v | 100 | 54 | % | Digital | Continuous | Incubation: 100 mM sodium acetate buffer, Assay: 100 mM sodium acetate buffer | Incubation: 4.5, Assay: 4.5 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM ABTS | ABTS radical cation | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (15 minutes at 30Β°C), measured by absorbance spectrophotometry (ABTS absorbance measurement, 420 nm) in aqueous phase | Methanol | 30 % v/v | 100 | 37 | % | Digital | Continuous | Incubation: 100 mM sodium acetate buffer, Assay: 100 mM sodium acetate buffer | Incubation: 4.5, Assay: 4.5 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM ABTS | ABTS radical cation | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (15 minutes at 30Β°C), measured by absorbance spectrophotometry (ABTS absorbance measurement, 420 nm) in aqueous phase | Methanol | 10 % v/v | 100 | 76 | % | Digital | Continuous | Incubation: 100 mM sodium acetate buffer, Assay: 100 mM sodium acetate buffer | Incubation: 4.5, Assay: 4.5 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM ABTS | ABTS radical cation | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (15 minutes at 30Β°C), measured by absorbance spectrophotometry (ABTS absorbance measurement, 420 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 30 % v/v | 100 | 19 | % | Digital | Continuous | Incubation: 100 mM sodium acetate buffer, Assay: 100 mM sodium acetate buffer | Incubation: 4.5, Assay: 4.5 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM ABTS | ABTS radical cation | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (15 minutes at 30Β°C), measured by absorbance spectrophotometry (ABTS absorbance measurement, 420 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 10 % v/v | 100 | 70 | % | Digital | Continuous | Incubation: 100 mM sodium acetate buffer, Assay: 100 mM sodium acetate buffer | Incubation: 4.5, Assay: 4.5 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM ABTS | ABTS radical cation | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (15 minutes at 30Β°C), measured by absorbance spectrophotometry (ABTS absorbance measurement, 420 nm) in aqueous phase | Acetone | 30 % v/v | 100 | 11 | % | Digital | Continuous | Incubation: 100 mM sodium acetate buffer, Assay: 100 mM sodium acetate buffer | Incubation: 4.5, Assay: 4.5 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM ABTS | ABTS radical cation | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (15 minutes at 30Β°C), measured by absorbance spectrophotometry (ABTS absorbance measurement, 420 nm) in aqueous phase | Acetone | 10 % v/v | 100 | 27 | % | Digital | Continuous | Incubation: 100 mM sodium acetate buffer, Assay: 100 mM sodium acetate buffer | Incubation: 4.5, Assay: 4.5 | Incubation: 30Β°C, Assay: 30Β°C | 1 mM ABTS | ABTS radical cation | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.