Esterase from Lactobacillus fermentum LF-12
Enzyme Description
Sequence
MKKVINVAVERDGLWLDSDIVYAQVPGWLGNATRNLRLSVIRHFATGDDTKFPVIFWFAGGGWMDTDHNIHLPNLVDFARAGYLVVGVEYRDSNKVNFPGQLEDAKAAIRYMRANAAKFQADPDRFVVMGESAGGHLASMLGLTNGMTEFDVGDHLDVSSDVQVAVPWYGVVDPLTAKQGSATDAFDFVYRNLLGAEPEDAPELDAKANPLTYVSKKSVPFLILHGQQDQVVPVKDSEVLYEALNQAGVDADLYELETAGHMDVQFMQPAVFKLILEFLKKHLN
Yujin Liu et al. (2020)
β Purification, characterization and molecular cloning of a dicaffeoylquinic acid-hydrolyzing esterase from human-derived Lactobacillus fermentum LF-12
Food & Function
Β· doi:10.1039/d0fo00029a β
Β· Activity - Classical
▼
Database ID
UniProt: A0A1D7ZZE6 β
Sequence Annotation
Explicit - Provided (first residue from UniProt sequence replaced by 7 first explicit residues from article)
Protein Source
Recombinant, host bacterium Escherichia coli Arctic-Expressβ’
Experimental Data (20 measurements)
20 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 15 % v/v | 100 | 63 | % | Digital | Continuous | Citric acidβsodium citrate buffer | ? | 45Β°C | ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- | Caffeic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent | Ethanol | 20 % v/v | 100 | 55 | % | Digital | Continuous | Citric acidβsodium citrate buffer | ? | 45Β°C | ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- | Caffeic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent | Ethanol | 15 % v/v | 100 | 58 | % | Digital | Continuous | Citric acidβsodium citrate buffer | ? | 45Β°C | ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- | Caffeic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent | Ethanol | 10 % v/v | 100 | 66 | % | Digital | Continuous | Citric acidβsodium citrate buffer | ? | 45Β°C | ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- | Caffeic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent | Ethanol | 5 % v/v | 100 | 79 | % | Digital | Continuous | Citric acidβsodium citrate buffer | ? | 45Β°C | ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- | Caffeic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent | Acetone | 20 % v/v | 100 | 36 | % | Digital | Continuous | Citric acidβsodium citrate buffer | ? | 45Β°C | ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- | Caffeic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent | Acetone | 15 % v/v | 100 | 50 | % | Digital | Continuous | Citric acidβsodium citrate buffer | ? | 45Β°C | ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- | Caffeic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent | Acetone | 10 % v/v | 100 | 59 | % | Digital | Continuous | Citric acidβsodium citrate buffer | ? | 45Β°C | ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- | Caffeic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent | Acetone | 5 % v/v | 100 | 66 | % | Digital | Continuous | Citric acidβsodium citrate buffer | ? | 45Β°C | ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- | Caffeic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 20 % v/v | 100 | 57 | % | Digital | Continuous | Citric acidβsodium citrate buffer | ? | 45Β°C | ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- | Caffeic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent | Methanol | 5 % v/v | 100 | 85 | % | Digital | Continuous | Citric acidβsodium citrate buffer | ? | 45Β°C | ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- | Caffeic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 10 % v/v | 100 | 77 | % | Digital | Continuous | Citric acidβsodium citrate buffer | ? | 45Β°C | ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- | Caffeic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 5 % v/v | 100 | 88 | % | Digital | Continuous | Citric acidβsodium citrate buffer | ? | 45Β°C | ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- | Caffeic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent | Acetonitrile | 20 % v/v | 100 | 42 | % | Digital | Continuous | Citric acidβsodium citrate buffer | ? | 45Β°C | ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- | Caffeic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent | Acetonitrile | 15 % v/v | 100 | 52 | % | Digital | Continuous | Citric acidβsodium citrate buffer | ? | 45Β°C | ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- | Caffeic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent | Acetonitrile | 10 % v/v | 100 | 73 | % | Digital | Continuous | Citric acidβsodium citrate buffer | ? | 45Β°C | ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- | Caffeic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent | Acetonitrile | 5 % v/v | 100 | 90 | % | Digital | Continuous | Citric acidβsodium citrate buffer | ? | 45Β°C | ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- | Caffeic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent | Methanol | 20 % v/v | 100 | 54 | % | Digital | Continuous | Citric acidβsodium citrate buffer | ? | 45Β°C | ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- | Caffeic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent | Methanol | 15 % v/v | 100 | 78 | % | Digital | Continuous | Citric acidβsodium citrate buffer | ? | 45Β°C | ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- | Caffeic acid | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (caffeic acid formation after 15 minutes incubatio at 45Β°C) in the presence of organic solvent | Methanol | 10 % v/v | 100 | 80 | % | Digital | Continuous | Citric acidβsodium citrate buffer | ? | 45Β°C | ? mM 3,5- and 4,5-DiCQA, ? mM Mixture of 3,4- | Caffeic acid | β | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.