Protease from Bacillus sphaericus DS11

Enzyme Description

Species
Bacillus sphaericus DS11 β†—
Extremophile
No
EC Number
3.4.- β†—

Sequence

Length: 431 amino acids
MKKMKSTLLSLLIAGSVINPVYATAMDSEDSLGNDGGQEKFRVYVEANKKTEKSTLKTQYSARWELTENGFSTDMNEKQFEALQKNKNFTVTKVPIVTLDTIGLEDDSMVENETLDLVTSLRASQQVPWGIKAIYNDSSLTSTSGGSDINIAVLDTGVYTSHADLVNTVEQCKDFTQSTPLVNGSCTDRNCHGTHVAGTALADGGSDGSGIYGVAPDADLWAYKVLTDSGSGYSDDIAAAIRHAADQATATGSKTIINMSLGSAGKDSLISSAVNYAYSKGALIVAAAGNSGYAQGSIGYPGALPNAIAVAALENVQQNGTYRVADYSSRGYASTAGDYVIQEGDIEISAPGAAVYSTMNNGGYNTISGTSMATPHVSGLAAKIWAENPSWSHAQLRANLQERAKSVDIKGGYGAAAGDDYASGFGFARVQ
Xincai Wu et al. (2020) β€” Expression and characterization of a novel organic solvent tolerant protease from Bacillus sphaericus DS11
Preparative Biochemistry & Biotechnology  Β· doi:10.1080/10826068.2020.1786839 β†—  Β· Stability - Incubation Activity + Stability - Incubation
12 measurements ▼
Database ID
UniProt: A0A481NVC6 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Bacillus subtilis WB800

Experimental Data (12 measurements)

12 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity + Stability - Incubation Activity after incubation (14 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, decrease in Azo-peptides absorbance measurement, 420 nm) in the presence of organic solvent Ethanol 25 % v/v 100 34 % Direct Continuous Incubation: ?, Assay: 200 mM Tris-HCl buffer, 1 mM CaCl2 Incubation: ?, Assay: 7.2 Incubation: 30Β°C, Assay: 40Β°C 0.01 Azocasein Azo-peptides , Peptides β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about substrate, here taken from the reference
Activity + Stability - Incubation Activity after incubation (14 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, decrease in Azo-peptides absorbance measurement, 420 nm) in the presence of organic solvent Methanol 25 % v/v 100 37 % Direct Continuous Incubation: ?, Assay: 200 mM Tris-HCl buffer, 1 mM CaCl2 Incubation: ?, Assay: 7.2 Incubation: 30Β°C, Assay: 40Β°C 0.01 Azocasein Azo-peptides , Peptides β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about substrate, here taken from the reference
Stability - Incubation Activity after incubation (14 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, decrease in Azo-peptides absorbance measurement, 420 nm) in aqueous phase n-Decane 25 % v/v 100 153 % Direct Continuous Incubation: ?, Assay: 200 mM Tris-HCl buffer, 1 mM CaCl2 Incubation: ?, Assay: 7.2 Incubation: 30Β°C, Assay: 40Β°C 0.01 Azocasein Azo-peptides , Peptides β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about substrate, here taken from the reference
Stability - Incubation Activity after incubation (14 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, decrease in Azo-peptides absorbance measurement, 420 nm) in aqueous phase n-Octane 25 % v/v 100 166 % Direct Continuous Incubation: ?, Assay: 200 mM Tris-HCl buffer, 1 mM CaCl2 Incubation: ?, Assay: 7.2 Incubation: 30Β°C, Assay: 40Β°C 0.01 Azocasein Azo-peptides , Peptides β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about substrate, here taken from the reference
Stability - Incubation Activity after incubation (14 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, decrease in Azo-peptides absorbance measurement, 420 nm) in aqueous phase Isooctane 25 % v/v 100 132 % Direct Continuous Incubation: ?, Assay: 200 mM Tris-HCl buffer, 1 mM CaCl2 Incubation: ?, Assay: 7.2 Incubation: 30Β°C, Assay: 40Β°C 0.01 Azocasein Azo-peptides , Peptides β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about substrate, here taken from the reference
Stability - Incubation Activity after incubation (14 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, decrease in Azo-peptides absorbance measurement, 420 nm) in aqueous phase n-Heptane 25 % v/v 100 136 % Direct Continuous Incubation: ?, Assay: 200 mM Tris-HCl buffer, 1 mM CaCl2 Incubation: ?, Assay: 7.2 Incubation: 30Β°C, Assay: 40Β°C 0.01 Azocasein Azo-peptides , Peptides β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about substrate, here taken from the reference
Stability - Incubation Activity after incubation (14 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, decrease in Azo-peptides absorbance measurement, 420 nm) in aqueous phase n-Hexane 25 % v/v 100 101 % Direct Continuous Incubation: ?, Assay: 200 mM Tris-HCl buffer, 1 mM CaCl2 Incubation: ?, Assay: 7.2 Incubation: 30Β°C, Assay: 40Β°C 0.01 Azocasein Azo-peptides , Peptides β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about substrate, here taken from the reference
Stability - Incubation Activity after incubation (14 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, decrease in Azo-peptides absorbance measurement, 420 nm) in aqueous phase p-Xylene 25 % v/v 100 99 % Direct Continuous Incubation: ?, Assay: 200 mM Tris-HCl buffer, 1 mM CaCl2 Incubation: ?, Assay: 7.2 Incubation: 30Β°C, Assay: 40Β°C 0.01 Azocasein Azo-peptides , Peptides β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about substrate, here taken from the reference
Stability - Incubation Activity after incubation (14 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, decrease in Azo-peptides absorbance measurement, 420 nm) in aqueous phase Toluene 25 % v/v 100 96 % Direct Continuous Incubation: ?, Assay: 200 mM Tris-HCl buffer, 1 mM CaCl2 Incubation: ?, Assay: 7.2 Incubation: 30Β°C, Assay: 40Β°C 0.01 Azocasein Azo-peptides , Peptides β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about substrate, here taken from the reference
Stability - Incubation Activity after incubation (14 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, decrease in Azo-peptides absorbance measurement, 420 nm) in aqueous phase Benzene 25 % v/v 100 84 % Direct Continuous Incubation: ?, Assay: 200 mM Tris-HCl buffer, 1 mM CaCl2 Incubation: ?, Assay: 7.2 Incubation: 30Β°C, Assay: 40Β°C 0.01 Azocasein Azo-peptides , Peptides β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about substrate, here taken from the reference
Stability - Incubation Activity after incubation (14 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, decrease in Azo-peptides absorbance measurement, 420 nm) in aqueous phase 1-Hexanol 25 % v/v 100 85 % Direct Continuous Incubation: ?, Assay: 200 mM Tris-HCl buffer, 1 mM CaCl2 Incubation: ?, Assay: 7.2 Incubation: 30Β°C, Assay: 40Β°C 0.01 Azocasein Azo-peptides , Peptides β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about substrate, here taken from the reference
Stability - Incubation Activity after incubation (14 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, decrease in Azo-peptides absorbance measurement, 420 nm) in aqueous phase 1-Butanol 25 % v/v 100 31 % Direct Continuous Incubation: ?, Assay: 200 mM Tris-HCl buffer, 1 mM CaCl2 Incubation: ?, Assay: 7.2 Incubation: 30Β°C, Assay: 40Β°C 0.01 Azocasein Azo-peptides , Peptides β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about substrate, here taken from the reference

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Activity + Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*