Xylanase (gene xyn) from Bacillus subtilis RTS

Enzyme Description

Species
Bacillus subtilis RTS β†—
Extremophile
No
EC Number
3.2.1.8 β†—

Sequence

Length: 185 amino acids
ASPDYWQNWTDGGGTVNAVNGPGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLALYGWTRAPLIEYYVVDSWGTYRPTGTYKGTVNSDGGTYDIYTTTRYNAPSIDGEKTTFTQYWSVRQTKRPHGSNAKITFSNHVRAWKSQGMNLGSIWSYQVLATEGYQSSGSSNVTVW
Aimen Saleem et al. (2021) β€” Biochemical characterization and molecular docking of cloned xylanase gene from Bacillus subtilis RTS expressed in E. coli
International Journal of Biological Macromolecules  Β· doi:10.1016/j.ijbiomac.2020.12.001 β†—  Β· Stability - Incubation
15 measurements ▼
Database ID
β€”
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (15 measurements)

15 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase Acetone 10 % v/v 100.0 92.1 % Digital Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 6.5 Incubation: Room temperature, Assay: 60Β°C 0.005 Soluble birchwood xylan Reducing sugars β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase Acetone 20 % v/v 100.0 77.9 % Digital Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 6.5 Incubation: Room temperature, Assay: 60Β°C 0.005 Soluble birchwood xylan Reducing sugars β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase Acetone 30 % v/v 100.0 71.9 % Digital Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 6.5 Incubation: Room temperature, Assay: 60Β°C 0.005 Soluble birchwood xylan Reducing sugars β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase Methanol 10 % v/v 100.0 70.0 % Digital Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 6.5 Incubation: Room temperature, Assay: 60Β°C 0.005 Soluble birchwood xylan Reducing sugars β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase Methanol 20 % v/v 100.0 64.9 % Digital Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 6.5 Incubation: Room temperature, Assay: 60Β°C 0.005 Soluble birchwood xylan Reducing sugars β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase Methanol 30 % v/v 100.0 50.0 % Digital Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 6.5 Incubation: Room temperature, Assay: 60Β°C 0.005 Soluble birchwood xylan Reducing sugars β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase Ethanol 10 % v/v 100.0 98.1 % Digital Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 6.5 Incubation: Room temperature, Assay: 60Β°C 0.005 Soluble birchwood xylan Reducing sugars β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase Ethanol 20 % v/v 100.0 92.1 % Digital Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 6.5 Incubation: Room temperature, Assay: 60Β°C 0.005 Soluble birchwood xylan Reducing sugars β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase Ethanol 30 % v/v 100.0 88.1 % Digital Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 6.5 Incubation: Room temperature, Assay: 60Β°C 0.005 Soluble birchwood xylan Reducing sugars β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase 1-Propanol 10 % v/v 100.0 81.1 % Digital Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 6.5 Incubation: Room temperature, Assay: 60Β°C 0.005 Soluble birchwood xylan Reducing sugars β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase 1-Propanol 20 % v/v 100.0 78.1 % Digital Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 6.5 Incubation: Room temperature, Assay: 60Β°C 0.005 Soluble birchwood xylan Reducing sugars β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase 1-Propanol 30 % v/v 100.0 75.1 % Digital Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 6.5 Incubation: Room temperature, Assay: 60Β°C 0.005 Soluble birchwood xylan Reducing sugars β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase 1-Butanol 10 % v/v 100.0 95.1 % Digital Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 6.5 Incubation: Room temperature, Assay: 60Β°C 0.005 Soluble birchwood xylan Reducing sugars β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase 1-Butanol 20 % v/v 100.0 88.1 % Digital Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 6.5 Incubation: Room temperature, Assay: 60Β°C 0.005 Soluble birchwood xylan Reducing sugars β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase 1-Butanol 30 % v/v 100.0 85.1 % Digital Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 6.5 Incubation: Room temperature, Assay: 60Β°C 0.005 Soluble birchwood xylan Reducing sugars β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*