Xylanase (gene xyn) from Bacillus subtilis RTS
Enzyme Description
Sequence
ASPDYWQNWTDGGGTVNAVNGPGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLALYGWTRAPLIEYYVVDSWGTYRPTGTYKGTVNSDGGTYDIYTTTRYNAPSIDGEKTTFTQYWSVRQTKRPHGSNAKITFSNHVRAWKSQGMNLGSIWSYQVLATEGYQSSGSSNVTVW
Aimen Saleem et al. (2021)
β Biochemical characterization and molecular docking of cloned xylanase gene from Bacillus subtilis RTS expressed in E. coli
International Journal of Biological Macromolecules
Β· doi:10.1016/j.ijbiomac.2020.12.001 β
Β· Stability - Incubation
▼
Database ID
β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (15 measurements)
15 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Acetone | 10 % v/v | 100.0 | 92.1 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer | Incubation: ?, Assay: 6.5 | Incubation: Room temperature, Assay: 60Β°C | 0.005 Soluble birchwood xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Acetone | 20 % v/v | 100.0 | 77.9 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer | Incubation: ?, Assay: 6.5 | Incubation: Room temperature, Assay: 60Β°C | 0.005 Soluble birchwood xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Acetone | 30 % v/v | 100.0 | 71.9 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer | Incubation: ?, Assay: 6.5 | Incubation: Room temperature, Assay: 60Β°C | 0.005 Soluble birchwood xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Methanol | 10 % v/v | 100.0 | 70.0 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer | Incubation: ?, Assay: 6.5 | Incubation: Room temperature, Assay: 60Β°C | 0.005 Soluble birchwood xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Methanol | 20 % v/v | 100.0 | 64.9 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer | Incubation: ?, Assay: 6.5 | Incubation: Room temperature, Assay: 60Β°C | 0.005 Soluble birchwood xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Methanol | 30 % v/v | 100.0 | 50.0 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer | Incubation: ?, Assay: 6.5 | Incubation: Room temperature, Assay: 60Β°C | 0.005 Soluble birchwood xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Ethanol | 10 % v/v | 100.0 | 98.1 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer | Incubation: ?, Assay: 6.5 | Incubation: Room temperature, Assay: 60Β°C | 0.005 Soluble birchwood xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Ethanol | 20 % v/v | 100.0 | 92.1 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer | Incubation: ?, Assay: 6.5 | Incubation: Room temperature, Assay: 60Β°C | 0.005 Soluble birchwood xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | Ethanol | 30 % v/v | 100.0 | 88.1 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer | Incubation: ?, Assay: 6.5 | Incubation: Room temperature, Assay: 60Β°C | 0.005 Soluble birchwood xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | 1-Propanol | 10 % v/v | 100.0 | 81.1 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer | Incubation: ?, Assay: 6.5 | Incubation: Room temperature, Assay: 60Β°C | 0.005 Soluble birchwood xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | 1-Propanol | 20 % v/v | 100.0 | 78.1 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer | Incubation: ?, Assay: 6.5 | Incubation: Room temperature, Assay: 60Β°C | 0.005 Soluble birchwood xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | 1-Propanol | 30 % v/v | 100.0 | 75.1 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer | Incubation: ?, Assay: 6.5 | Incubation: Room temperature, Assay: 60Β°C | 0.005 Soluble birchwood xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | 1-Butanol | 10 % v/v | 100.0 | 95.1 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer | Incubation: ?, Assay: 6.5 | Incubation: Room temperature, Assay: 60Β°C | 0.005 Soluble birchwood xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | 1-Butanol | 20 % v/v | 100.0 | 88.1 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer | Incubation: ?, Assay: 6.5 | Incubation: Room temperature, Assay: 60Β°C | 0.005 Soluble birchwood xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (DNS assay, 540 nm) in aqueous phase | 1-Butanol | 30 % v/v | 100.0 | 85.1 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer | Incubation: ?, Assay: 6.5 | Incubation: Room temperature, Assay: 60Β°C | 0.005 Soluble birchwood xylan | Reducing sugars | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.