Subtilisin from Bacillus amyloliquefaciens HM48
Enzyme Description
Extremophile
No
but "thermostable" and "alkalistable" organism
EC Number
Sequence
SNVKVAVIDSGIDSSHPDLNVAGGASMVPSETNPFQDSNSHGTHVAGTVAALNNSIGVLGVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAPP
Hina Mushtaq et al. (2021)
β Biochemical Characterization and Functional Analysis of Heat Stable High Potential Protease of Bacillus amyloliquefaciens Strain HM48 from Soils of Dachigam National Park in Kashmir Himalaya
▼
Database ID
UniProt: A0A6M6C9U8 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Purified, bacterium Bacillus amyloliquefaciens HM48
Experimental Data (6 measurements)
6 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | Benzene | ? | 100 | 85 | % | Digital | Continuous | 83 mM Tris-HCl buffer | 8 | 70Β°C | 0.54% (w/v) Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | Toluene | ? | 100 | 86 | % | Digital | Continuous | 83 mM Tris-HCl buffer | 8 | 70Β°C | 0.54% (w/v) Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | Xylene | ? | 100 | 97 | % | Digital | Continuous | 83 mM Tris-HCl buffer | 8 | 70Β°C | 0.54% (w/v) Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Stability - Incubation | Activity after incubation (30 minutes at 35Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase | Benzene | ? | 100 | 71 | % | Digital | Continuous | Incubation: ?, Assay: 83 mM Tris-HCl buffer | Incubation: ?, Assay: 8 | Incubation: 35Β°C, Assay: 70Β°C | 0.54% (w/v) Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (30 minutes at 35Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase | Toluene | ? | 100 | 80 | % | Digital | Continuous | Incubation: ?, Assay: 83 mM Tris-HCl buffer | Incubation: ?, Assay: 8 | Incubation: 35Β°C, Assay: 70Β°C | 0.54% (w/v) Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (30 minutes at 35Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase | Xylene | ? | 100 | 87 | % | Digital | Continuous | Incubation: ?, Assay: 83 mM Tris-HCl buffer | Incubation: ?, Assay: 8 | Incubation: 35Β°C, Assay: 70Β°C | 0.54% (w/v) Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent, uncertainty about control |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.