Lipase LK4 from a compost metagenomic library
Enzyme Description
Sequence
MNKNKTLLALCLGSALALSGQAFAATGSGYTATKYPIVLAHGMLGFDSLLGIDYWYGIPSALRRDGAQVYVTEVSQLNTSELRGEELLAQVEEIVAISGKPKVNLIGHSHGGPTIRYVAGVRPDLIASVTSVGAPHKGSDVADLIRKVPEGSSGEAIIAGLVNAMGAFINFVSGSSSTAPQNSQGSLESLNSEGAARFNAKFPHGIPTTACGEGAYKVDGVHYYSWSGTSPLTNPLDVSDAMMGAGSLAFSGPNDGLVGRCSSHLGMVIRDNYRMNHLDEVNQFMGLTSLFETDPVSVYRQHANRLKNAGL
Ilma Fauziah Ma'ruf et al. (2021)
β Effect of mutation at oxyanion hole residu (H110F) on activity of Lk4 lipase
Biotechnology Reports
Β· doi:10.1016/j.btre.2021.e00590 β
Β· Activity - Classical
▼
Database ID
UniProt: A0A0E3M1J0 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (14 measurements)
14 measurements
| Mutation | Property | Assay | Solvent | Solvent Volume | Aqueous Reference | WT Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| WT | Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | Ethanol | 3 % v/v | 100 | β | 33 | % | Digital | Continuous | 37.5 mM sodium phosphate buffer, 3% Ethanol | 9 | 40Β°C | 0.3 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| WT | Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | Methanol | 3 % v/v | 100 | β | 32 | % | Digital | Continuous | 37.5 mM sodium phosphate buffer, 3% Ethanol | 9 | 40Β°C | 0.3 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| WT | Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | 1-Propanol | 3 % v/v | 100 | β | 39 | % | Digital | Continuous | 37.5 mM sodium phosphate buffer, 3% Ethanol | 9 | 40Β°C | 0.3 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| WT | Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | Acetonitrile | 3 % v/v | 100 | β | 30 | % | Digital | Continuous | 37.5 mM sodium phosphate buffer, 3% Ethanol | 9 | 40Β°C | 0.3 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| WT | Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | Acetone | 3 % v/v | 100 | β | 24 | % | Digital | Continuous | 37.5 mM sodium phosphate buffer, 3% Ethanol | 9 | 40Β°C | 0.3 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| WT | Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | Chloroform | 3 % v/v | 100 | β | 0 | % | Digital | Continuous | 37.5 mM sodium phosphate buffer, 3% Ethanol | 9 | 40Β°C | 0.3 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| WT | Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | n-Hexane | 3 % v/v | 100 | β | 0 | % | Digital | Continuous | 37.5 mM sodium phosphate buffer, 3% Ethanol | 9 | 40Β°C | 0.3 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| H110F | Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | Ethanol | 3 % v/v | 100 | 33 | 100 | % | Digital | Continuous | 37.5 mM sodium phosphate buffer, 3% Ethanol | 9 | 40Β°C | 0.3 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| H110F | Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | Methanol | 3 % v/v | 100 | 32 | 99 | % | Digital | Continuous | 37.5 mM sodium phosphate buffer, 3% Ethanol | 9 | 40Β°C | 0.3 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| H110F | Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | 1-Propanol | 3 % v/v | 100 | 39 | 110 | % | Digital | Continuous | 37.5 mM sodium phosphate buffer, 3% Ethanol | 9 | 40Β°C | 0.3 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| H110F | Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | Acetonitrile | 3 % v/v | 100 | 30 | 106 | % | Digital | Continuous | 37.5 mM sodium phosphate buffer, 3% Ethanol | 9 | 40Β°C | 0.3 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| H110F | Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | Acetone | 3 % v/v | 100 | 24 | 87 | % | Digital | Continuous | 37.5 mM sodium phosphate buffer, 3% Ethanol | 9 | 40Β°C | 0.3 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| H110F | Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | Chloroform | 3 % v/v | 100 | 10 | 10 | % | Digital | Continuous | 37.5 mM sodium phosphate buffer, 3% Ethanol | 9 | 40Β°C | 0.3 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| H110F | Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | n-Hexane | 3 % v/v | 100 | 0 | 51 | % | Digital | Continuous | 37.5 mM sodium phosphate buffer, 3% Ethanol | 9 | 40Β°C | 0.3 mM p-Nitrophenyl decanoate | Decanoic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
Mutations in this dataset (2)
WT
H110F
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume. β β β Reference value. Hover for details.
Mutation Effect
Mutation impact on enzyme stability and function in the presence of organic solvent: comparison of wild-type and mutant values in identical conditions.