Lipase from Rhizopus Oryzae KU45
Enzyme Description
Sequence
SDGGKVVAATTAQIQEFTKYAGIAATAYCRSVVPGNKWDCVQCQKWVPDGKIITTFTSLLSDTNGYVLRSDKQKTIYLVFRGTNSFRSAITDIVFNFSDYKPVKGAKVHAGFLSSYEQVVNDYFPVIQEQLTANPTYKVIVTGHSLGGAQALLAGMDLYQREPRLSPKNLSIFTVGGPRVGNPTFAYYVESTGIPFQRTVHKRDIVPHVPPQSFGFLHPGVESWIKSGTSNVQICTSEIETKDCSNSIVPFTSLLDHLSYFDINEGSCL
Alper ArslanoΔlu et al. (2020)
β Gene Cloning, Heterologous Expression and Biochemical Characterization of A Novel Extracellular Lipase from Rhizopus Oryzae KU45
Iran Journal of Biotechnology
Β· doi:10.30498/IJB.2020.141895.2343 β
Β· Activity - Classical
▼
Database ID
β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (7 measurements)
7 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in the presence of organic solvent | Ethanol | 30 % v/v | 100.0 | 80.33 | % | Direct | Continuous | 100 mM TrisβHCl buffer, 150 mM NaCl, 0.5% Triton X-100, 1% acetonitrile | 8 | 45Β°C | 0.5 mM p-Nitrophenyl laurate | Lauric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) | Close UniProt sequence : D0EHQ8 (123 first residues from UniProt sequence removed from mature protein, 1 mutation A7V from mature sequence) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in the presence of organic solvent | Methanol | 30 % v/v | 100.0 | 117.66 | % | Direct | Continuous | 100 mM TrisβHCl buffer, 150 mM NaCl, 0.5% Triton X-100, 1% acetonitrile | 8 | 45Β°C | 0.5 mM p-Nitrophenyl laurate | Lauric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) | Close UniProt sequence : D0EHQ8 (123 first residues from UniProt sequence removed from mature protein, 1 mutation A7V from mature sequence) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in the presence of organic solvent | Acetone | 30 % v/v | 100.0 | 30.33 | % | Direct | Continuous | 100 mM TrisβHCl buffer, 150 mM NaCl, 0.5% Triton X-100, 1% acetonitrile | 8 | 45Β°C | 0.5 mM p-Nitrophenyl laurate | Lauric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) | Close UniProt sequence : D0EHQ8 (123 first residues from UniProt sequence removed from mature protein, 1 mutation A7V from mature sequence) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in the presence of organic solvent | 1-Propanol | 30 % v/v | 100.0 | 37.0 | % | Direct | Continuous | 100 mM TrisβHCl buffer, 150 mM NaCl, 0.5% Triton X-100, 1% acetonitrile | 8 | 45Β°C | 0.5 mM p-Nitrophenyl laurate | Lauric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) | Close UniProt sequence : D0EHQ8 (123 first residues from UniProt sequence removed from mature protein, 1 mutation A7V from mature sequence) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in the presence of organic solvent | n-Hexane | 30 % v/v | 100.0 | 0.0 | % | Direct | Continuous | 100 mM TrisβHCl buffer, 150 mM NaCl, 0.5% Triton X-100, 1% acetonitrile | 8 | 45Β°C | 0.5 mM p-Nitrophenyl laurate | Lauric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) | Close UniProt sequence : D0EHQ8 (123 first residues from UniProt sequence removed from mature protein, 1 mutation A7V from mature sequence) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 30 % v/v | 100.0 | 39.0 | % | Direct | Continuous | 100 mM TrisβHCl buffer, 150 mM NaCl, 0.5% Triton X-100, 1% acetonitrile | 8 | 45Β°C | 0.5 mM p-Nitrophenyl laurate | Lauric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) | Close UniProt sequence : D0EHQ8 (123 first residues from UniProt sequence removed from mature protein, 1 mutation A7V from mature sequence) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 400 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 30 % v/v | 100.0 | 123.33 | % | Direct | Continuous | 100 mM TrisβHCl buffer, 150 mM NaCl, 0.5% Triton X-100, 1% acetonitrile | 8 | 45Β°C | 0.5 mM p-Nitrophenyl laurate | Lauric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) | Close UniProt sequence : D0EHQ8 (123 first residues from UniProt sequence removed from mature protein, 1 mutation A7V from mature sequence) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.