Amidase (gene amiA) from Microvirga flocculans CGMCC 1.16731
Enzyme Description
Sequence
MTTTRDKLETILARLAGRAADERVFLRVYEDAARIAADAADARRRGGLSLGPLDGAIVSIKDLFDVAGETTLAGSIALRDAPPADRDAAIVRRLRQAGAVIIGRTNMVEFAFSGLGLNPHYGTPGNAADPLRIPGGSSSGAGVSVAEGTSEISIGSDTGGSVRIPAALNGVVGFKPTAHRVPLDGTFPLAPSLDSIGPLARNVQDCAFTDAVMAGEDPRVLKPQPLAGLRIGVPRGRLFTQTEPMVEQAFEDSLTRLSEAGARIADHGIEDLLEAMAQITETASIASIEASEVHADWLNAKAAEIDPRVRWWIARSSTVPAPTYIRMLRRRRVLAAAMDERLSPIDVLALPATAIPAPLIAPFEGDDKLYNKMDGLILRNTMFGNQFDLTAISLPVPGTALPVGLMLVARHGHDRRLLEIAAGVETLLARGA
Yun-Xiu Zhao et al. (2021)
β Biodegradation of the pyridinecarboxamide insecticide flonicamid by Microvirga flocculans and characterization of two novel amidases involved
Ecotoxicology and Environmental Safety
Β· doi:10.1016/j.ecoenv.2021.112384 β
Β· Activity - Classical
▼
Database ID
UniProt: A0A7G7XYM0 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli Rosetta (DE3) pLys
Experimental Data (7 measurements)
7 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by HPLC (4-(trifluoromethyl) nicotinol glycine formation) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | ? | 100 | 94 | % | Digital | Continuous | ? | 6 | 50Β°C | 0.75 mM N-(4-Trifluoromethylnicotinoyl)glycinamide glycinamide | 4-(trifluoromethyl) nicotinol glycine | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (4-(trifluoromethyl) nicotinol glycine formation) in the presence of organic solvent | Acetone | ? | 100 | 71 | % | Digital | Continuous | ? | 6 | 50Β°C | 0.75 mM N-(4-Trifluoromethylnicotinoyl)glycinamide glycinamide | 4-(trifluoromethyl) nicotinol glycine | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (4-(trifluoromethyl) nicotinol glycine formation) in the presence of organic solvent | 1-Butanol | ? | 100 | 53 | % | Digital | Continuous | ? | 6 | 50Β°C | 0.75 mM N-(4-Trifluoromethylnicotinoyl)glycinamide glycinamide | 4-(trifluoromethyl) nicotinol glycine | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (4-(trifluoromethyl) nicotinol glycine formation) in the presence of organic solvent | Methanol | ? | 100 | 93 | % | Digital | Continuous | ? | 6 | 50Β°C | 0.75 mM N-(4-Trifluoromethylnicotinoyl)glycinamide glycinamide | 4-(trifluoromethyl) nicotinol glycine | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (4-(trifluoromethyl) nicotinol glycine formation) in the presence of organic solvent | Ethanol | ? | 100 | 86 | % | Digital | Continuous | ? | 6 | 50Β°C | 0.75 mM N-(4-Trifluoromethylnicotinoyl)glycinamide glycinamide | 4-(trifluoromethyl) nicotinol glycine | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (4-(trifluoromethyl) nicotinol glycine formation) in the presence of organic solvent | Ethyl Acetate | ? | 100 | 77 | % | Digital | Continuous | ? | 6 | 50Β°C | 0.75 mM N-(4-Trifluoromethylnicotinoyl)glycinamide glycinamide | 4-(trifluoromethyl) nicotinol glycine | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (4-(trifluoromethyl) nicotinol glycine formation) in the presence of organic solvent | Isopropanol | ? | 100 | 78 | % | Digital | Continuous | ? | 6 | 50Β°C | 0.75 mM N-(4-Trifluoromethylnicotinoyl)glycinamide glycinamide | 4-(trifluoromethyl) nicotinol glycine | β | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.