Lipase 1 from Pseudomonas marinensis gcc21

Enzyme Description

Species
Pseudomonas marinensis gcc21 β†—
Extremophile
No but "cold-active" enzyme
EC Number
3.1.1.3 β†—

Sequence

Length: 290 amino acids
MMNLPVMKLSALTLGLALSASALAGNPPGQNPPGDLPVDSGFPAVSDFAADGPFATTANSEGPSCRISRPRTLGEDGLKHPIIIWGNGTGGGATTYAGLHEHWASHGFVVAAATTANAGSGEEMIACLDYLVQQNGRSGGTYGGKLDLNRVGASGHSQGGGGTIMAGQDPRITTTAPFQPYVLGLGHVSSSQRNQNGPMFLMTGSDDTLAGSTLNGRPVFRNANVPVFWGELQGVDHFEPVGDAGGYRGPSTAWYRYQLMGDQNAAGVFEGSDCTLCTSRDWDVQKKNFN
Chenchen Guo et al. (2021) β€” Characterization of Two Unique Cold-Active Lipases Derived from a Novel Deep-Sea Cold Seep Bacterium
Microorganisms  Β· doi:10.3390/microorganisms9040802 β†—  Β· Stability - Incubation
14 measurements ▼
Database ID
UniParc: UPI0014529E2C β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (14 measurements)

14 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Xylene 1 % v/v 2.5 0.82 U/mg Digital Continuous Incubation: ?, Assay: 40 mM Tris-HCl buffer, 10% isopropyl alcohol Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 4Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in U/mg), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Xylene 10 % v/v 2.5 0.66 U/mg Digital Continuous Incubation: ?, Assay: 40 mM Tris-HCl buffer, 10% isopropyl alcohol Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 4Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in U/mg), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase 1-Butanol 1 % v/v 2.5 1.6 U/mg Digital Continuous Incubation: ?, Assay: 40 mM Tris-HCl buffer, 10% isopropyl alcohol Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 4Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in U/mg), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase 1-Butanol 10 % v/v 2.5 0.74 U/mg Digital Continuous Incubation: ?, Assay: 40 mM Tris-HCl buffer, 10% isopropyl alcohol Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 4Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in U/mg), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 1 % v/v 2.5 1.06 U/mg Digital Continuous Incubation: ?, Assay: 40 mM Tris-HCl buffer, 10% isopropyl alcohol Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 4Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in U/mg), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 10 % v/v 2.5 0.91 U/mg Digital Continuous Incubation: ?, Assay: 40 mM Tris-HCl buffer, 10% isopropyl alcohol Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 4Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in U/mg), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Methanol 1 % v/v 2.5 1.32 U/mg Digital Continuous Incubation: ?, Assay: 40 mM Tris-HCl buffer, 10% isopropyl alcohol Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 4Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in U/mg), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Methanol 10 % v/v 2.5 0.78 U/mg Digital Continuous Incubation: ?, Assay: 40 mM Tris-HCl buffer, 10% isopropyl alcohol Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 4Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in U/mg), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Ethanol 1 % v/v 2.5 1.88 U/mg Digital Continuous Incubation: ?, Assay: 40 mM Tris-HCl buffer, 10% isopropyl alcohol Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 4Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in U/mg), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Ethanol 10 % v/v 2.5 0.59 U/mg Digital Continuous Incubation: ?, Assay: 40 mM Tris-HCl buffer, 10% isopropyl alcohol Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 4Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in U/mg), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Glycerol 1 % v/v 2.5 1.74 U/mg Digital Continuous Incubation: ?, Assay: 40 mM Tris-HCl buffer, 10% isopropyl alcohol Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 4Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in U/mg), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Glycerol 10 % v/v 2.5 1.6 U/mg Digital Continuous Incubation: ?, Assay: 40 mM Tris-HCl buffer, 10% isopropyl alcohol Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 4Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in U/mg), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase p-Xylene 1 % v/v 2.5 0.28 U/mg Digital Continuous Incubation: ?, Assay: 40 mM Tris-HCl buffer, 10% isopropyl alcohol Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 4Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in U/mg), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase p-Xylene 10 % v/v 2.5 0.02 U/mg Digital Continuous Incubation: ?, Assay: 40 mM Tris-HCl buffer, 10% isopropyl alcohol Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 4Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in U/mg), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*