Serine protease SAPA from Anoxybacillus kamchatkensis M1V

Enzyme Description

Extremophile
Yes thermophilic organism
EC Number

Sequence

Length: 385 amino acids
MNNKMLLVIIMSLIFFTFNIPKTFADNNHEQRYFVTFKEEVDTDYIKEKEGKIIRQFNTSSSVLIEASSETIQRIKDNNEIVSIELDVEVEIDEAYETDWGLIDIDPQEQLIPWNIDYIGSTYAHQIDITGKNVKVGIIDSGINPHKDLKVSGGINIVGNNGNYYDDYGHGTKVAGIIAALDNSYGIIGVAPDVELYSIKVLKSNGKGSISDVVAGIEWAIENDIDILNFSLQTTIDNSVLRNAIQKAYENNILLVASAGNMGGTKKVDTVTYPAAYDEVIAVAAVDKNGERASYSSTGKRIDISAPGDYVYTTVQSGLYFLATGTSMAAPHVSGVAALVLECQPNLDVEELRKILLKSKKPFGNPKLYGKGIIDVPKAIKFSKN
Akli Ouelhadj et al. (2020) β€” Identification and homology modeling of a new biotechnologically compatible serine alkaline protease from moderately halotolerant Gracilibacillus boraciitolerans strain LO15
International Journal of Biological Macromolecules  Β· doi:10.1016/j.ijbiomac.2020.07.266 β†—  Β· Activity - Classical
10 measurements
Database ID
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
?

Experimental Data (10 measurements)

10 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent n-Decane 25 % v/v 100 72 % Digital Continuous 83 mM glycine-NaOH buffer 10 60Β°C 0.008 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent n-Octane 25 % v/v 100 120 % Digital Continuous 83 mM glycine-NaOH buffer 10 60Β°C 0.008 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent n-Hexane 25 % v/v 100 99 % Digital Continuous 83 mM glycine-NaOH buffer 10 60Β°C 0.008 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent Toluene 25 % v/v 100 79 % Digital Continuous 83 mM glycine-NaOH buffer 10 60Β°C 0.008 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent Chloroform 25 % v/v 100 122 % Digital Continuous 83 mM glycine-NaOH buffer 10 60Β°C 0.008 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent 1-Butanol 25 % v/v 100 104 % Digital Continuous 83 mM glycine-NaOH buffer 10 60Β°C 0.008 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent Isopropanol 25 % v/v 100 99 % Digital Continuous 83 mM glycine-NaOH buffer 10 60Β°C 0.008 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent Acetonitrile 25 % v/v 100 0 % Digital Continuous 83 mM glycine-NaOH buffer 10 60Β°C 0.008 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent Methanol 25 % v/v 100 111 % Digital Continuous 83 mM glycine-NaOH buffer 10 60Β°C 0.008 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 25 % v/v 100 107 % Digital Continuous 83 mM glycine-NaOH buffer 10 60Β°C 0.008 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*