Serine protease SAPA from Anoxybacillus kamchatkensis M1V
Enzyme Description
Extremophile
Yes
thermophilic organism
EC Number
Sequence
MNNKMLLVIIMSLIFFTFNIPKTFADNNHEQRYFVTFKEEVDTDYIKEKEGKIIRQFNTSSSVLIEASSETIQRIKDNNEIVSIELDVEVEIDEAYETDWGLIDIDPQEQLIPWNIDYIGSTYAHQIDITGKNVKVGIIDSGINPHKDLKVSGGINIVGNNGNYYDDYGHGTKVAGIIAALDNSYGIIGVAPDVELYSIKVLKSNGKGSISDVVAGIEWAIENDIDILNFSLQTTIDNSVLRNAIQKAYENNILLVASAGNMGGTKKVDTVTYPAAYDEVIAVAAVDKNGERASYSSTGKRIDISAPGDYVYTTVQSGLYFLATGTSMAAPHVSGVAALVLECQPNLDVEELRKILLKSKKPFGNPKLYGKGIIDVPKAIKFSKN
Akli Ouelhadj et al. (2020)
β Identification and homology modeling of a new biotechnologically compatible serine alkaline protease from moderately halotolerant Gracilibacillus boraciitolerans strain LO15
International Journal of Biological Macromolecules
Β· doi:10.1016/j.ijbiomac.2020.07.266 β
Β· Activity - Classical
▼
Database ID
UniParc: UPI0007B4CD98 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
?
Experimental Data (10 measurements)
10 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | n-Decane | 25 % v/v | 100 | 72 | % | Digital | Continuous | 83 mM glycine-NaOH buffer | 10 | 60Β°C | 0.008 Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | n-Octane | 25 % v/v | 100 | 120 | % | Digital | Continuous | 83 mM glycine-NaOH buffer | 10 | 60Β°C | 0.008 Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | n-Hexane | 25 % v/v | 100 | 99 | % | Digital | Continuous | 83 mM glycine-NaOH buffer | 10 | 60Β°C | 0.008 Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | Toluene | 25 % v/v | 100 | 79 | % | Digital | Continuous | 83 mM glycine-NaOH buffer | 10 | 60Β°C | 0.008 Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | Chloroform | 25 % v/v | 100 | 122 | % | Digital | Continuous | 83 mM glycine-NaOH buffer | 10 | 60Β°C | 0.008 Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | 1-Butanol | 25 % v/v | 100 | 104 | % | Digital | Continuous | 83 mM glycine-NaOH buffer | 10 | 60Β°C | 0.008 Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | Isopropanol | 25 % v/v | 100 | 99 | % | Digital | Continuous | 83 mM glycine-NaOH buffer | 10 | 60Β°C | 0.008 Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | Acetonitrile | 25 % v/v | 100 | 0 | % | Digital | Continuous | 83 mM glycine-NaOH buffer | 10 | 60Β°C | 0.008 Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | Methanol | 25 % v/v | 100 | 111 | % | Digital | Continuous | 83 mM glycine-NaOH buffer | 10 | 60Β°C | 0.008 Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction product absorbance measurement, 660 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 25 % v/v | 100 | 107 | % | Digital | Continuous | 83 mM glycine-NaOH buffer | 10 | 60Β°C | 0.008 Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.