Nitrilase A (gene NitA) from Variovorax boronicumulans CGMCC 4969
Enzyme Description
Sequence
MPTTVHPQLRVAAVQAAPVFLDLDATIDKTIDLMAQAAKQSVQLIAFPETWVPGYPWWVWLDSPAWGMQFVQRYHDNSLIIGSPEFERLQAAARQHRIWLSLGYSEKAAGSLYIAQALIDDQGRTVQTRRKLKPTHVERTVFGEGDGADLHVVQTPLGNIGSLCCWEHLQPLSKYAMYAQNEQIHCGAWPSFSLYRGAAYALGHEVNNAASQVYAVEGGCFVIAPCATVSKAMSELMCTDDGKRQMLGVGGGHARIYGPDGSPLGTPLAEDAEGLVIADIDLGMIALAKAAADPSGHYSRPDVTQLLLNKTRRTPVVVQLTPEPEGSVPEPVVA
Huoyong Jiang et al. (2022)
β Characterization of nitrilases from Variovorax boronicumulans that functions in insecticide flonicamid degradation and Ξ²-cyano-L-alanine detoxification
Journal of Applied Microbiology
Β· doi:10.1111/jam.15561 β
Β· Activity - Classical
▼
Database ID
UniProt: A0A250DJF8 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli Rosetta
Experimental Data (8 measurements)
8 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by HPLC (N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM), 4-(trifluoromethyl)nicotinoyl glycine (TFNG) product formation measurement) in the presence of organic solvent | Acetone | 2 % v/v | 100 | 25 | % | Digital | Continuous | 50 mM PBS buffer | 7 | 37Β°C | 0.84 mM Flonicamid | 4-(trifluoromethyl)nicotinoyl glycine (TFNG) , N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM) | β | 800 rpm | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM), 4-(trifluoromethyl)nicotinoyl glycine (TFNG) product formation measurement) in the presence of organic solvent | Cyclohexane | 2 % v/v | 100 | 2 | % | Digital | Continuous | 50 mM PBS buffer | 7 | 37Β°C | 0.84 mM Flonicamid | 4-(trifluoromethyl)nicotinoyl glycine (TFNG) , N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM) | β | 800 rpm | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM), 4-(trifluoromethyl)nicotinoyl glycine (TFNG) product formation measurement) in the presence of organic solvent | Methanol | 2 % v/v | 100 | 76 | % | Digital | Continuous | 50 mM PBS buffer | 7 | 37Β°C | 0.84 mM Flonicamid | 4-(trifluoromethyl)nicotinoyl glycine (TFNG) , N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM) | β | 800 rpm | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM), 4-(trifluoromethyl)nicotinoyl glycine (TFNG) product formation measurement) in the presence of organic solvent | Ethanol | 2 % v/v | 100 | 66 | % | Digital | Continuous | 50 mM PBS buffer | 7 | 37Β°C | 0.84 mM Flonicamid | 4-(trifluoromethyl)nicotinoyl glycine (TFNG) , N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM) | β | 800 rpm | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM), 4-(trifluoromethyl)nicotinoyl glycine (TFNG) product formation measurement) in the presence of organic solvent | Isopropanol | 2 % v/v | 100 | 43 | % | Digital | Continuous | 50 mM PBS buffer | 7 | 37Β°C | 0.84 mM Flonicamid | 4-(trifluoromethyl)nicotinoyl glycine (TFNG) , N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM) | β | 800 rpm | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM), 4-(trifluoromethyl)nicotinoyl glycine (TFNG) product formation measurement) in the presence of organic solvent | 1-Butanol | 2 % v/v | 100 | 2 | % | Digital | Continuous | 50 mM PBS buffer | 7 | 37Β°C | 0.84 mM Flonicamid | 4-(trifluoromethyl)nicotinoyl glycine (TFNG) , N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM) | β | 800 rpm | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM), 4-(trifluoromethyl)nicotinoyl glycine (TFNG) product formation measurement) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 2 % v/v | 100 | 79 | % | Digital | Continuous | 50 mM PBS buffer | 7 | 37Β°C | 0.84 mM Flonicamid | 4-(trifluoromethyl)nicotinoyl glycine (TFNG) , N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM) | β | 800 rpm | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by HPLC (N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM), 4-(trifluoromethyl)nicotinoyl glycine (TFNG) product formation measurement) in the presence of organic solvent | Acetic Acid | 2 % v/v | 100 | 2 | % | Digital | Continuous | 50 mM PBS buffer | 7 | 37Β°C | 0.84 mM Flonicamid | 4-(trifluoromethyl)nicotinoyl glycine (TFNG) , N-(4-trifluoromethylnicotinoyl)glycinamide (TFNG-AM) | β | 800 rpm | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.