GH36 Ξ±-Galactosidase (gene galV) from Anoxybacillus vitaminiphilus WMF1

Enzyme Description

Extremophile
Yes "thermophilic" organism
EC Number

Sequence

Length: 727 amino acids
MGIIYNDSTKTFHLQAKDTSYIMQVVRSGYLAHLYWGKKIREVNMPRKLQFLDRAFSPNPEPADRSFSLDTLPQEYPAYGNTDFRTPAYQVQFENGTTVSDLRYQSHRIFKGKPKLEGLPATYIENENEAESLEIVLHDVVSSLKAVLLYTVYENFNVITRSVRFENEGEQTIKLLRALSMNVDFFHADYELLHLSGAWARERHIERRPLVVGTQSIESRRGASSHQHNPFIALLQKGAGEYHGEVYGFSLVYSGNFLAQVEVDQYKTARVSLGINPFDFTWLLEPGESFQTPEVVMVYSANGLNDMSNTYHKLYRTRLARGQYRDQERPILINNWEATYFHFNEEKILQIAEAGKELGIELFVLDGWFGKRDNDKSSLGDWFVDKNKLPNGMESLARKVRSMGMQFGLWFEPEMISVDSELYRRHPDWCLHVPNRSRSEGRNQLILDYSRREVCDYVIKAVSDILKSAPISYVKWDMNRHMTEIGSSALPPERQRETAHRYMLGLYRVMEEITSAFPHVLFESCSGGGGRFDPGILYYMPQTWTSDNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVHRVTSLDIRGNVAMSGNFGYELDLTKLTEQEKEKVKEQVAFYKEIRHLVQYGDFYRILSPFEGNETAWMFVSEDKSEAFVAYFRVLAEPNAPLSFLRLKGLDPNKNYQLLENGEVYGGDELMYIGLNIPQLQGDYVSCVWRLKAC
Jialing Wang et al. (2021) β€” Identification and Characterization of a Thermostable GH36 Ξ±-Galactosidase from Anoxybacillus vitaminiphilus WMF1 and Its Application in Synthesizing Isofloridoside by Reverse Hydrolysis
International Journal of Molecular Sciences  Β· doi:10.3390/ijms221910778 β†—  Β· Stability - Incubation
3 measurements
Database ID
β€”
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (3 measurements)

3 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 1 % v/v 100.0 100.0 % Direct Continuous Incubation: ?, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 7.5 Incubation: Room temperature, Assay: 35Β°C 10 mM p-Nitrophenyl Ξ±-D-galactopyranoside D-Glucose , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Methanol 1 % v/v 100.0 100.0 % Direct Continuous Incubation: ?, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 7.5 Incubation: Room temperature, Assay: 35Β°C 10 mM p-Nitrophenyl Ξ±-D-galactopyranoside D-Glucose , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Acetonitrile 1 % v/v 100.0 3.43 % Direct Continuous Incubation: ?, Assay: 50 mM sodium phosphate buffer Incubation: ?, Assay: 7.5 Incubation: Room temperature, Assay: 35Β°C 10 mM p-Nitrophenyl Ξ±-D-galactopyranoside D-Glucose , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*