GH36 Ξ±-Galactosidase (gene galV) from Anoxybacillus vitaminiphilus WMF1
Enzyme Description
Extremophile
Yes
"thermophilic" organism
EC Number
Sequence
MGIIYNDSTKTFHLQAKDTSYIMQVVRSGYLAHLYWGKKIREVNMPRKLQFLDRAFSPNPEPADRSFSLDTLPQEYPAYGNTDFRTPAYQVQFENGTTVSDLRYQSHRIFKGKPKLEGLPATYIENENEAESLEIVLHDVVSSLKAVLLYTVYENFNVITRSVRFENEGEQTIKLLRALSMNVDFFHADYELLHLSGAWARERHIERRPLVVGTQSIESRRGASSHQHNPFIALLQKGAGEYHGEVYGFSLVYSGNFLAQVEVDQYKTARVSLGINPFDFTWLLEPGESFQTPEVVMVYSANGLNDMSNTYHKLYRTRLARGQYRDQERPILINNWEATYFHFNEEKILQIAEAGKELGIELFVLDGWFGKRDNDKSSLGDWFVDKNKLPNGMESLARKVRSMGMQFGLWFEPEMISVDSELYRRHPDWCLHVPNRSRSEGRNQLILDYSRREVCDYVIKAVSDILKSAPISYVKWDMNRHMTEIGSSALPPERQRETAHRYMLGLYRVMEEITSAFPHVLFESCSGGGGRFDPGILYYMPQTWTSDNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVHRVTSLDIRGNVAMSGNFGYELDLTKLTEQEKEKVKEQVAFYKEIRHLVQYGDFYRILSPFEGNETAWMFVSEDKSEAFVAYFRVLAEPNAPLSFLRLKGLDPNKNYQLLENGEVYGGDELMYIGLNIPQLQGDYVSCVWRLKAC
Jialing Wang et al. (2021)
β Identification and Characterization of a Thermostable GH36 Ξ±-Galactosidase from Anoxybacillus vitaminiphilus WMF1 and Its Application in Synthesizing Isofloridoside by Reverse Hydrolysis
International Journal of Molecular Sciences
Β· doi:10.3390/ijms221910778 β
Β· Stability - Incubation
▼
Database ID
β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (3 measurements)
3 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 1 % v/v | 100.0 | 100.0 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM sodium phosphate buffer | Incubation: ?, Assay: 7.5 | Incubation: Room temperature, Assay: 35Β°C | 10 mM p-Nitrophenyl Ξ±-D-galactopyranoside | D-Glucose , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Methanol | 1 % v/v | 100.0 | 100.0 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM sodium phosphate buffer | Incubation: ?, Assay: 7.5 | Incubation: Room temperature, Assay: 35Β°C | 10 mM p-Nitrophenyl Ξ±-D-galactopyranoside | D-Glucose , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Acetonitrile | 1 % v/v | 100.0 | 3.43 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM sodium phosphate buffer | Incubation: ?, Assay: 7.5 | Incubation: Room temperature, Assay: 35Β°C | 10 mM p-Nitrophenyl Ξ±-D-galactopyranoside | D-Glucose , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.