Trypsin from Bos taurus (bovine)

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 223 amino acids
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Guillermo R. Castro et al. (1999) β€” Enzymatic activities of proteases dissolved in organic solvents
Enzyme and Microbial Technology  Β· doi:10.1016/S0141-0229(99)00099-X β†—  Β· Activity - Michaelis-Menten
3 measurements
Database ID
UniProt: P00760 β†—
Sequence Annotation
Inferred - from protein name (23 first residues from UniProt sequence absent from the mature protein)
Protein Source
Commercially purchased

Experimental Data (3 measurements)

3 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Michaelis-Menten Km (mM) measured by HPLC in the presence of organic solvent Glycerol 99 % v/v 2.7 25.0 mM Direct Continuous 20 mM phosphate buffer 7.8 30Β°C Phenyl acetate Acetic Acid , Phenol β€” β€” Classical aqueous control (in mM)
Activity - Michaelis-Menten Vmax (Β΅M/s mg) measured by HPLC in the presence of organic solvent Glycerol 99 % v/v 0.46 0.17 Β΅M/(s * mg) Direct Continuous 20 mM phosphate buffer 7.8 30Β°C Phenyl acetate Acetic Acid , Phenol β€” β€” Classical aqueous control (in microM/(s * mg))
Activity - Michaelis-Menten Vm/Km (1/s mg) measured by HPLC in the presence of organic solvent Glycerol 99 % v/v 0.17 0.0068 1/(s * mg) Direct Continuous 20 mM phosphate buffer 7.8 30Β°C Phenyl acetate Acetic Acid , Phenol β€” β€” Classical aqueous control (in 1/(s * mg))

Visualization : Activity β€” Michaelis-Menten

Guillermo R. Castro et al. (1999)

One bar per measurement. Colour = solvent, shade = solvent volume.

L.M. Simon et al. (2001) β€” Structure and Activity of Ξ±-Chymotrypsin and Trypsin in Aqueous Organic Media.
Biochemical and Biophysical Research Communications  Β· doi:10.1006/bbrc.2001.4282 β†—  Β· Activity - Michaelis-Menten Stability - Incubation
48 measurements
Andrew M.J. Crowell et al. (2013) β€” Critical assessment of the spectroscopic activity assay for monitoring trypsin activity in organic–aqueous solvent
Analytical Biochemistry  Β· doi:10.1016/j.ab.2012.12.019 β†—  Β· Activity - Classical
14 measurements

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*