Laccase (gene PthLac) from Parageobacillus thermoglucosidasius
Enzyme Description
Extremophile
Yes
"thermophilic" organism
EC Number
Sequence
MLDIFQQAGEEMLLLHGRCSFPNLVAGFTTKHGGVSKGAFATFNLGLHVGDEVSSVCRNRQRLADLLQFPLEQWVCCEQIHDARIEKVTSSQSGKGAADYKSAIAGTDGLYTKEAGLLLALCFADCVPLYFMAPKHGMIGLAHAGWRGTVKNIAGEMIHLWHEREHIPLDDIYVAIGPAIGACCYIVDDRVITYVDCILDGEQAPYKQVSIGQYALDLKELNKVLLIQAGVREEHIDISGYCTSCADYLFFSHRRDQGKTGRMMAFIGRKGE
Xifeng Wang et al. (2023)
β Characterization of a Novel One-Domain Halotolerant Laccase from Parageobacillus thermoglucosidasius and Its Application in Dye Decolorization
Applied Biochemistry and Biotechnology
Β· doi:10.1007/s12010-023-04389-x β
Β· Activity - Classical
▼
Database ID
UniParc: UPI000B56F0B7 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (9 measurements)
9 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (tetraguaiacol absorbance measurement, 465 nm) in the presence of organic solvent | Ethanol | 5 % v/v | 100.0 | 97.2 | % | Direct | Continuous | 50 mM phosphate buffer | 6 | Room temperature | 3 mM Guaiacol | Tetraguaiacol | 10 mM CuΒ²βΊ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (tetraguaiacol absorbance measurement, 465 nm) in the presence of organic solvent | Ethanol | 10 % v/v | 100.0 | 89.4 | % | Direct | Continuous | 50 mM phosphate buffer | 6 | Room temperature | 3 mM Guaiacol | Tetraguaiacol | 10 mM CuΒ²βΊ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (tetraguaiacol absorbance measurement, 465 nm) in the presence of organic solvent | Ethanol | 20 % v/v | 100.0 | 70.1 | % | Direct | Continuous | 50 mM phosphate buffer | 6 | Room temperature | 3 mM Guaiacol | Tetraguaiacol | 10 mM CuΒ²βΊ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (tetraguaiacol absorbance measurement, 465 nm) in the presence of organic solvent | Acetone | 5 % v/v | 100.0 | 97.4 | % | Direct | Continuous | 50 mM phosphate buffer | 6 | Room temperature | 3 mM Guaiacol | Tetraguaiacol | 10 mM CuΒ²βΊ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (tetraguaiacol absorbance measurement, 465 nm) in the presence of organic solvent | Acetone | 10 % v/v | 100.0 | 80.7 | % | Direct | Continuous | 50 mM phosphate buffer | 6 | Room temperature | 3 mM Guaiacol | Tetraguaiacol | 10 mM CuΒ²βΊ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (tetraguaiacol absorbance measurement, 465 nm) in the presence of organic solvent | Acetone | 20 % v/v | 100.0 | 60.3 | % | Direct | Continuous | 50 mM phosphate buffer | 6 | Room temperature | 3 mM Guaiacol | Tetraguaiacol | 10 mM CuΒ²βΊ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (tetraguaiacol absorbance measurement, 465 nm) in the presence of organic solvent | Methanol | 5 % v/v | 100.0 | 98.6 | % | Direct | Continuous | 50 mM phosphate buffer | 6 | Room temperature | 3 mM Guaiacol | Tetraguaiacol | 10 mM CuΒ²βΊ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (tetraguaiacol absorbance measurement, 465 nm) in the presence of organic solvent | Methanol | 10 % v/v | 100.0 | 82.4 | % | Direct | Continuous | 50 mM phosphate buffer | 6 | Room temperature | 3 mM Guaiacol | Tetraguaiacol | 10 mM CuΒ²βΊ | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (tetraguaiacol absorbance measurement, 465 nm) in the presence of organic solvent | Methanol | 20 % v/v | 100.0 | 65.3 | % | Direct | Continuous | 50 mM phosphate buffer | 6 | Room temperature | 3 mM Guaiacol | Tetraguaiacol | 10 mM CuΒ²βΊ | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.