Peroxidase from Armoracia rusticana (horseradish)

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 353 amino acids
MHFSSSSTLFTCITLIPLVCLILHASLSDAQLTPTFYDNSCPNVSNIVRDTIVNELRSDPRIAASILRLHFHDCFVNGCDASILLDNTTSFRTEKDAFGNANSARGFPVIDRMKAAVESACPRTVSCADLLTIAAQQSVTLAGGPSWRVPLGRRDSLQAFLDLANANLPAPFFTLPQLKDSFRNVGLNRSSDLVALSGGHTFGKNQCRFIMDRLYNFSNTGLPDPTLNTTYLQTLRGLCPLNGNLSALVDFDLRTPTIFDNKYYVNLEEQKGLIQSDQELFSSPNATDTIPLVRSFANSTQTFFNAFVEAMDRMGNITPLTGTQGQIRLNCRVVNSNSLLHDMVEVVDFVSSM
Masaru Akita et al. (2001) β€” Structural Change and Catalytic Activity of Horseradish Peroxidase in Oxidative Polymerization of Phenol
Bioscience, Biotechnology, and Biochemistry  Β· doi:10.1271/bbb.65.1581 β†—  Β· Activity + Stability - Product Formation
15 measurements
Database ID
UniProt: P00433 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Commercially purchased

Experimental Data (15 measurements)

15 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity + Stability - Product Formation Polymer yield after incubation (4 hours at 30Β°C) in the presence of organic solvent measured as the ratio of product weight to added phenol monomer weight 1,4-Dioxane 20 % v/v 16 99 % Direct Continuous Distilled water ? 30Β°C Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 2.5 mmol Phenol Phenoxy radical , that polymerizes β€” β€” Classical aqueous control (in %)
Activity + Stability - Product Formation Polymer yield after incubation (4 hours at 30Β°C) in the presence of organic solvent measured as the ratio of product weight to added phenol monomer weight 1,4-Dioxane 40 % v/v 16 99 % Direct Continuous Distilled water ? 30Β°C Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 2.5 mmol Phenol Phenoxy radical , that polymerizes β€” β€” Classical aqueous control (in %)
Activity + Stability - Product Formation Polymer yield after incubation (4 hours at 30Β°C) in the presence of organic solvent measured as the ratio of product weight to added phenol monomer weight 1,4-Dioxane 60 % v/v 16 99 % Direct Continuous Distilled water ? 30Β°C Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 2.5 mmol Phenol Phenoxy radical , that polymerizes β€” β€” Classical aqueous control (in %)
Activity + Stability - Product Formation Polymer yield after incubation (4 hours at 30Β°C) in the presence of organic solvent measured as the ratio of product weight to added phenol monomer weight 1,4-Dioxane 80 % v/v 16 77 % Direct Continuous Distilled water ? 30Β°C Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 2.5 mmol Phenol Phenoxy radical , that polymerizes β€” β€” Classical aqueous control (in %)
Activity + Stability - Product Formation Polymer yield after incubation (4 hours at 30Β°C) in the presence of organic solvent measured as the ratio of product weight to added phenol monomer weight 1,4-Dioxane 100 % v/v 16 0 % Direct Continuous Distilled water ? 30Β°C Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 2.5 mmol Phenol Phenoxy radical , that polymerizes β€” β€” Classical aqueous control (in %)
Activity + Stability - Product Formation Polymer yield after incubation (4 hours at 30Β°C) in the presence of organic solvent measured as the ratio of product weight to added phenol monomer weight Dimethylformamide (DMF) 20 % v/v 16 99 % Direct Continuous Distilled water ? 30Β°C Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 2.5 mmol Phenol Phenoxy radical , that polymerizes β€” β€” Classical aqueous control (in %)
Activity + Stability - Product Formation Polymer yield after incubation (4 hours at 30Β°C) in the presence of organic solvent measured as the ratio of product weight to added phenol monomer weight Dimethylformamide (DMF) 40 % v/v 16 99 % Direct Continuous Distilled water ? 30Β°C Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 2.5 mmol Phenol Phenoxy radical , that polymerizes β€” β€” Classical aqueous control (in %)
Activity + Stability - Product Formation Polymer yield after incubation (4 hours at 30Β°C) in the presence of organic solvent measured as the ratio of product weight to added phenol monomer weight Dimethylformamide (DMF) 60 % v/v 16 98 % Direct Continuous Distilled water ? 30Β°C Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 2.5 mmol Phenol Phenoxy radical , that polymerizes β€” β€” Classical aqueous control (in %)
Activity + Stability - Product Formation Polymer yield after incubation (4 hours at 30Β°C) in the presence of organic solvent measured as the ratio of product weight to added phenol monomer weight Dimethylformamide (DMF) 80 % v/v 16 1 % Direct Continuous Distilled water ? 30Β°C Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 2.5 mmol Phenol Phenoxy radical , that polymerizes β€” β€” Classical aqueous control (in %)
Activity + Stability - Product Formation Polymer yield after incubation (4 hours at 30Β°C) in the presence of organic solvent measured as the ratio of product weight to added phenol monomer weight Dimethylformamide (DMF) 100 % v/v 16 0 % Direct Continuous Distilled water ? 30Β°C Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 2.5 mmol Phenol Phenoxy radical , that polymerizes β€” β€” Classical aqueous control (in %)
Activity + Stability - Product Formation Polymer yield after incubation (4 hours at 30Β°C) in the presence of organic solvent measured as the ratio of product weight to added phenol monomer weight Methanol 20 % v/v 16 20 % Direct Continuous Distilled water ? 30Β°C Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 2.5 mmol Phenol Phenoxy radical , that polymerizes β€” β€” Classical aqueous control (in %)
Activity + Stability - Product Formation Polymer yield after incubation (4 hours at 30Β°C) in the presence of organic solvent measured as the ratio of product weight to added phenol monomer weight Methanol 40 % v/v 16 76 % Direct Continuous Distilled water ? 30Β°C Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 2.5 mmol Phenol Phenoxy radical , that polymerizes β€” β€” Classical aqueous control (in %)
Activity + Stability - Product Formation Polymer yield after incubation (4 hours at 30Β°C) in the presence of organic solvent measured as the ratio of product weight to added phenol monomer weight Methanol 60 % v/v 16 98 % Direct Continuous Distilled water ? 30Β°C Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 2.5 mmol Phenol Phenoxy radical , that polymerizes β€” β€” Classical aqueous control (in %)
Activity + Stability - Product Formation Polymer yield after incubation (4 hours at 30Β°C) in the presence of organic solvent measured as the ratio of product weight to added phenol monomer weight Methanol 80 % v/v 16 91 % Direct Continuous Distilled water ? 30Β°C Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 2.5 mmol Phenol Phenoxy radical , that polymerizes β€” β€” Classical aqueous control (in %)
Activity + Stability - Product Formation Polymer yield after incubation (4 hours at 30Β°C) in the presence of organic solvent measured as the ratio of product weight to added phenol monomer weight Methanol 100 % v/v 16 0 % Direct Continuous Distilled water ? 30Β°C Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 2.5 mmol Phenol Phenoxy radical , that polymerizes β€” β€” Classical aqueous control (in %)

Visualization : Activity + Stability β€” Product Formation

Masaru Akita et al. (2001)

One bar per measurement. Colour = solvent, shade = solvent volume.

Jian-Zhong Liu et al. (2006) β€” Increased thermal and organic solvent tolerance of modified horseradish peroxidase
Protein Engineering, Design and Selection  Β· doi:10.1093/protein/gzj016 β†—  Β· Stability - Incubation
15 measurements

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*