Peroxidase from Armoracia rusticana (horseradish)
Enzyme Description
Sequence
MHFSSSSTLFTCITLIPLVCLILHASLSDAQLTPTFYDNSCPNVSNIVRDTIVNELRSDPRIAASILRLHFHDCFVNGCDASILLDNTTSFRTEKDAFGNANSARGFPVIDRMKAAVESACPRTVSCADLLTIAAQQSVTLAGGPSWRVPLGRRDSLQAFLDLANANLPAPFFTLPQLKDSFRNVGLNRSSDLVALSGGHTFGKNQCRFIMDRLYNFSNTGLPDPTLNTTYLQTLRGLCPLNGNLSALVDFDLRTPTIFDNKYYVNLEEQKGLIQSDQELFSSPNATDTIPLVRSFANSTQTFFNAFVEAMDRMGNITPLTGTQGQIRLNCRVVNSNSLLHDMVEVVDFVSSM
Masaru Akita et al. (2001)
β Structural Change and Catalytic Activity of Horseradish Peroxidase in Oxidative Polymerization of Phenol
Bioscience, Biotechnology, and Biochemistry
Β· doi:10.1271/bbb.65.1581 β
Β· Activity + Stability - Product Formation
▼
Database ID
UniProt: P00433 β
Sequence Annotation
Inferred - from protein name
Protein Source
Commercially purchased
Experimental Data (15 measurements)
15 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity + Stability - Product Formation | Polymer yield after incubation (4 hours at 30Β°C) in the presence of organic solvent measured as the ratio of product weight to added phenol monomer weight | 1,4-Dioxane | 20 % v/v | 16 | 99 | % | Direct | Continuous | Distilled water | ? | 30Β°C | HβOβ (Hydrogen Peroxide), 2.5 mmol Phenol | Phenoxy radical , that polymerizes | β | β | Classical aqueous control (in %) |
| Activity + Stability - Product Formation | Polymer yield after incubation (4 hours at 30Β°C) in the presence of organic solvent measured as the ratio of product weight to added phenol monomer weight | 1,4-Dioxane | 40 % v/v | 16 | 99 | % | Direct | Continuous | Distilled water | ? | 30Β°C | HβOβ (Hydrogen Peroxide), 2.5 mmol Phenol | Phenoxy radical , that polymerizes | β | β | Classical aqueous control (in %) |
| Activity + Stability - Product Formation | Polymer yield after incubation (4 hours at 30Β°C) in the presence of organic solvent measured as the ratio of product weight to added phenol monomer weight | 1,4-Dioxane | 60 % v/v | 16 | 99 | % | Direct | Continuous | Distilled water | ? | 30Β°C | HβOβ (Hydrogen Peroxide), 2.5 mmol Phenol | Phenoxy radical , that polymerizes | β | β | Classical aqueous control (in %) |
| Activity + Stability - Product Formation | Polymer yield after incubation (4 hours at 30Β°C) in the presence of organic solvent measured as the ratio of product weight to added phenol monomer weight | 1,4-Dioxane | 80 % v/v | 16 | 77 | % | Direct | Continuous | Distilled water | ? | 30Β°C | HβOβ (Hydrogen Peroxide), 2.5 mmol Phenol | Phenoxy radical , that polymerizes | β | β | Classical aqueous control (in %) |
| Activity + Stability - Product Formation | Polymer yield after incubation (4 hours at 30Β°C) in the presence of organic solvent measured as the ratio of product weight to added phenol monomer weight | 1,4-Dioxane | 100 % v/v | 16 | 0 | % | Direct | Continuous | Distilled water | ? | 30Β°C | HβOβ (Hydrogen Peroxide), 2.5 mmol Phenol | Phenoxy radical , that polymerizes | β | β | Classical aqueous control (in %) |
| Activity + Stability - Product Formation | Polymer yield after incubation (4 hours at 30Β°C) in the presence of organic solvent measured as the ratio of product weight to added phenol monomer weight | Dimethylformamide (DMF) | 20 % v/v | 16 | 99 | % | Direct | Continuous | Distilled water | ? | 30Β°C | HβOβ (Hydrogen Peroxide), 2.5 mmol Phenol | Phenoxy radical , that polymerizes | β | β | Classical aqueous control (in %) |
| Activity + Stability - Product Formation | Polymer yield after incubation (4 hours at 30Β°C) in the presence of organic solvent measured as the ratio of product weight to added phenol monomer weight | Dimethylformamide (DMF) | 40 % v/v | 16 | 99 | % | Direct | Continuous | Distilled water | ? | 30Β°C | HβOβ (Hydrogen Peroxide), 2.5 mmol Phenol | Phenoxy radical , that polymerizes | β | β | Classical aqueous control (in %) |
| Activity + Stability - Product Formation | Polymer yield after incubation (4 hours at 30Β°C) in the presence of organic solvent measured as the ratio of product weight to added phenol monomer weight | Dimethylformamide (DMF) | 60 % v/v | 16 | 98 | % | Direct | Continuous | Distilled water | ? | 30Β°C | HβOβ (Hydrogen Peroxide), 2.5 mmol Phenol | Phenoxy radical , that polymerizes | β | β | Classical aqueous control (in %) |
| Activity + Stability - Product Formation | Polymer yield after incubation (4 hours at 30Β°C) in the presence of organic solvent measured as the ratio of product weight to added phenol monomer weight | Dimethylformamide (DMF) | 80 % v/v | 16 | 1 | % | Direct | Continuous | Distilled water | ? | 30Β°C | HβOβ (Hydrogen Peroxide), 2.5 mmol Phenol | Phenoxy radical , that polymerizes | β | β | Classical aqueous control (in %) |
| Activity + Stability - Product Formation | Polymer yield after incubation (4 hours at 30Β°C) in the presence of organic solvent measured as the ratio of product weight to added phenol monomer weight | Dimethylformamide (DMF) | 100 % v/v | 16 | 0 | % | Direct | Continuous | Distilled water | ? | 30Β°C | HβOβ (Hydrogen Peroxide), 2.5 mmol Phenol | Phenoxy radical , that polymerizes | β | β | Classical aqueous control (in %) |
| Activity + Stability - Product Formation | Polymer yield after incubation (4 hours at 30Β°C) in the presence of organic solvent measured as the ratio of product weight to added phenol monomer weight | Methanol | 20 % v/v | 16 | 20 | % | Direct | Continuous | Distilled water | ? | 30Β°C | HβOβ (Hydrogen Peroxide), 2.5 mmol Phenol | Phenoxy radical , that polymerizes | β | β | Classical aqueous control (in %) |
| Activity + Stability - Product Formation | Polymer yield after incubation (4 hours at 30Β°C) in the presence of organic solvent measured as the ratio of product weight to added phenol monomer weight | Methanol | 40 % v/v | 16 | 76 | % | Direct | Continuous | Distilled water | ? | 30Β°C | HβOβ (Hydrogen Peroxide), 2.5 mmol Phenol | Phenoxy radical , that polymerizes | β | β | Classical aqueous control (in %) |
| Activity + Stability - Product Formation | Polymer yield after incubation (4 hours at 30Β°C) in the presence of organic solvent measured as the ratio of product weight to added phenol monomer weight | Methanol | 60 % v/v | 16 | 98 | % | Direct | Continuous | Distilled water | ? | 30Β°C | HβOβ (Hydrogen Peroxide), 2.5 mmol Phenol | Phenoxy radical , that polymerizes | β | β | Classical aqueous control (in %) |
| Activity + Stability - Product Formation | Polymer yield after incubation (4 hours at 30Β°C) in the presence of organic solvent measured as the ratio of product weight to added phenol monomer weight | Methanol | 80 % v/v | 16 | 91 | % | Direct | Continuous | Distilled water | ? | 30Β°C | HβOβ (Hydrogen Peroxide), 2.5 mmol Phenol | Phenoxy radical , that polymerizes | β | β | Classical aqueous control (in %) |
| Activity + Stability - Product Formation | Polymer yield after incubation (4 hours at 30Β°C) in the presence of organic solvent measured as the ratio of product weight to added phenol monomer weight | Methanol | 100 % v/v | 16 | 0 | % | Direct | Continuous | Distilled water | ? | 30Β°C | HβOβ (Hydrogen Peroxide), 2.5 mmol Phenol | Phenoxy radical , that polymerizes | β | β | Classical aqueous control (in %) |
Visualization : Activity + Stability β Product Formation
Masaru Akita et al. (2001)
One bar per measurement. Colour = solvent, shade = solvent volume.
Jian-Zhong Liu et al. (2006)
β Increased thermal and organic solvent tolerance of modified horseradish peroxidase
Protein Engineering, Design and Selection
Β· doi:10.1093/protein/gzj016 β
Β· Stability - Incubation
▼
Database ID
UniProt: P00433 β
Sequence Annotation
Inferred (but other isozymes exist)
Protein Source
Commercially purchased
Experimental Data (15 measurements)
15 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (colorimetric assay, radical phenol and 4-Aminoantipyrine reaction product absorbance measurement, 510 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 10 % v/v | 100 | 94 | % | Digital | Continuous | Incubation: 0.1 M phosphate buffer, Assay: 0.01 M phosphate buffer, 2.4 mM 4-Aminoantipyrine | Incubation: 7.4, Assay: 7 | Incubation: Room temperature, Assay: 30Β°C | HβOβ (Hydrogen Peroxide), 10 mM Phenol | H2O , Phenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (colorimetric assay, radical phenol and 4-Aminoantipyrine reaction product absorbance measurement, 510 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 20 % v/v | 100 | 88 | % | Digital | Continuous | Incubation: 0.1 M phosphate buffer, Assay: 0.01 M phosphate buffer, 2.4 mM 4-Aminoantipyrine | Incubation: 7.4, Assay: 7 | Incubation: Room temperature, Assay: 30Β°C | HβOβ (Hydrogen Peroxide), 10 mM Phenol | H2O , Phenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (colorimetric assay, radical phenol and 4-Aminoantipyrine reaction product absorbance measurement, 510 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 30 % v/v | 100 | 84 | % | Digital | Continuous | Incubation: 0.1 M phosphate buffer, Assay: 0.01 M phosphate buffer, 2.4 mM 4-Aminoantipyrine | Incubation: 7.4, Assay: 7 | Incubation: Room temperature, Assay: 30Β°C | HβOβ (Hydrogen Peroxide), 10 mM Phenol | H2O , Phenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (colorimetric assay, radical phenol and 4-Aminoantipyrine reaction product absorbance measurement, 510 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 40 % v/v | 100 | 83 | % | Digital | Continuous | Incubation: 0.1 M phosphate buffer, Assay: 0.01 M phosphate buffer, 2.4 mM 4-Aminoantipyrine | Incubation: 7.4, Assay: 7 | Incubation: Room temperature, Assay: 30Β°C | HβOβ (Hydrogen Peroxide), 10 mM Phenol | H2O , Phenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (colorimetric assay, radical phenol and 4-Aminoantipyrine reaction product absorbance measurement, 510 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 50 % v/v | 100 | 61 | % | Digital | Continuous | Incubation: 0.1 M phosphate buffer, Assay: 0.01 M phosphate buffer, 2.4 mM 4-Aminoantipyrine | Incubation: 7.4, Assay: 7 | Incubation: Room temperature, Assay: 30Β°C | HβOβ (Hydrogen Peroxide), 10 mM Phenol | H2O , Phenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (colorimetric assay, radical phenol and 4-Aminoantipyrine reaction product absorbance measurement, 510 nm) in aqueous phase | Tetrahydrofuran (THF) | 10 % v/v | 100 | 96 | % | Digital | Continuous | Incubation: 0.1 M phosphate buffer, Assay: 0.01 M phosphate buffer, 2.4 mM 4-Aminoantipyrine | Incubation: 7.4, Assay: 7 | Incubation: Room temperature, Assay: 30Β°C | HβOβ (Hydrogen Peroxide), 10 mM Phenol | H2O , Phenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (colorimetric assay, radical phenol and 4-Aminoantipyrine reaction product absorbance measurement, 510 nm) in aqueous phase | Tetrahydrofuran (THF) | 20 % v/v | 100 | 67 | % | Digital | Continuous | Incubation: 0.1 M phosphate buffer, Assay: 0.01 M phosphate buffer, 2.4 mM 4-Aminoantipyrine | Incubation: 7.4, Assay: 7 | Incubation: Room temperature, Assay: 30Β°C | HβOβ (Hydrogen Peroxide), 10 mM Phenol | H2O , Phenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (colorimetric assay, radical phenol and 4-Aminoantipyrine reaction product absorbance measurement, 510 nm) in aqueous phase | Tetrahydrofuran (THF) | 30 % v/v | 100 | 53 | % | Digital | Continuous | Incubation: 0.1 M phosphate buffer, Assay: 0.01 M phosphate buffer, 2.4 mM 4-Aminoantipyrine | Incubation: 7.4, Assay: 7 | Incubation: Room temperature, Assay: 30Β°C | HβOβ (Hydrogen Peroxide), 10 mM Phenol | H2O , Phenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (colorimetric assay, radical phenol and 4-Aminoantipyrine reaction product absorbance measurement, 510 nm) in aqueous phase | Tetrahydrofuran (THF) | 40 % v/v | 100 | 43 | % | Digital | Continuous | Incubation: 0.1 M phosphate buffer, Assay: 0.01 M phosphate buffer, 2.4 mM 4-Aminoantipyrine | Incubation: 7.4, Assay: 7 | Incubation: Room temperature, Assay: 30Β°C | HβOβ (Hydrogen Peroxide), 10 mM Phenol | H2O , Phenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (colorimetric assay, radical phenol and 4-Aminoantipyrine reaction product absorbance measurement, 510 nm) in aqueous phase | Tetrahydrofuran (THF) | 50 % v/v | 100 | 35 | % | Digital | Continuous | Incubation: 0.1 M phosphate buffer, Assay: 0.01 M phosphate buffer, 2.4 mM 4-Aminoantipyrine | Incubation: 7.4, Assay: 7 | Incubation: Room temperature, Assay: 30Β°C | HβOβ (Hydrogen Peroxide), 10 mM Phenol | H2O , Phenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (colorimetric assay, radical phenol and 4-Aminoantipyrine reaction product absorbance measurement, 510 nm) in aqueous phase | Dimethylformamide (DMF) | 10 % v/v | 100 | 80 | % | Digital | Continuous | Incubation: 0.1 M phosphate buffer, Assay: 0.01 M phosphate buffer, 2.4 mM 4-Aminoantipyrine | Incubation: 7.4, Assay: 7 | Incubation: Room temperature, Assay: 30Β°C | HβOβ (Hydrogen Peroxide), 10 mM Phenol | H2O , Phenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (colorimetric assay, radical phenol and 4-Aminoantipyrine reaction product absorbance measurement, 510 nm) in aqueous phase | Dimethylformamide (DMF) | 20 % v/v | 100 | 69 | % | Digital | Continuous | Incubation: 0.1 M phosphate buffer, Assay: 0.01 M phosphate buffer, 2.4 mM 4-Aminoantipyrine | Incubation: 7.4, Assay: 7 | Incubation: Room temperature, Assay: 30Β°C | HβOβ (Hydrogen Peroxide), 10 mM Phenol | H2O , Phenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (colorimetric assay, radical phenol and 4-Aminoantipyrine reaction product absorbance measurement, 510 nm) in aqueous phase | Dimethylformamide (DMF) | 30 % v/v | 100 | 53 | % | Digital | Continuous | Incubation: 0.1 M phosphate buffer, Assay: 0.01 M phosphate buffer, 2.4 mM 4-Aminoantipyrine | Incubation: 7.4, Assay: 7 | Incubation: Room temperature, Assay: 30Β°C | HβOβ (Hydrogen Peroxide), 10 mM Phenol | H2O , Phenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (colorimetric assay, radical phenol and 4-Aminoantipyrine reaction product absorbance measurement, 510 nm) in aqueous phase | Dimethylformamide (DMF) | 40 % v/v | 100 | 38 | % | Digital | Continuous | Incubation: 0.1 M phosphate buffer, Assay: 0.01 M phosphate buffer, 2.4 mM 4-Aminoantipyrine | Incubation: 7.4, Assay: 7 | Incubation: Room temperature, Assay: 30Β°C | HβOβ (Hydrogen Peroxide), 10 mM Phenol | H2O , Phenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (colorimetric assay, radical phenol and 4-Aminoantipyrine reaction product absorbance measurement, 510 nm) in aqueous phase | Dimethylformamide (DMF) | 50 % v/v | 100 | 37 | % | Digital | Continuous | Incubation: 0.1 M phosphate buffer, Assay: 0.01 M phosphate buffer, 2.4 mM 4-Aminoantipyrine | Incubation: 7.4, Assay: 7 | Incubation: Room temperature, Assay: 30Β°C | HβOβ (Hydrogen Peroxide), 10 mM Phenol | H2O , Phenoxy radical | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
Visualization : Stability β Incubation
Jian-Zhong Liu et al. (2006)
One bar per measurement. Colour = solvent, shade = solvent volume.