Serine protease (gene SpSKF4) from Geobacillus thermoglucosidasius SKF4

Enzyme Description

Extremophile
Yes "thermophilic" organism
EC Number

Sequence

Length: 401 amino acids
MKFKAIVSLSLAVSMSFFPFLVEAASNDGVESPKTVSEINVSHEKGAYVQGEVIVQFKEQVNAEEKAKALKEVGATAVPDNDRVKSKFNVLKVGNVEAVVKALNNNPLVEYAEPNYLFNAAWTPNDTYYQGYQYGPQNTYTDYAWDVTKGSSGQEIAVIDTGVDYTHPDLDGKVIKGYDFVDNDYDPMDLNNHGTHVAGIAAAETNNATGIAGMAPNTRILAVRALDRNGSGTLSDIADAIIYAADSGAEVINLSLGCDCHTTTLENAVNYAWNKGSVVVAAAGNNGSSTTFEPASYENVIAVGAVDQYDRLASFSNYGTWVDVVAPGVDIVSTITGNRYAYMSGTSMASPHVAGLAALLASQGRNNIEIRQAIEQTADKISGTGTYFKYGRINSYNAVTY
Suleiman D Allison et al. (2023) β€” Molecular Cloning, Characterization, and Application of Organic Solvent-Stable and Detergent-Compatible Thermostable Alkaline Protease from Geobacillus thermoglucosidasius SKF4
Journal of Microbiology and Biotechnology  Β· doi:10.4014/jmb.2306.06050 β†—  Β· Stability - Incubation
21 measurements
Database ID
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (21 measurements)

21 measurements β€” page 2 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (40 minutes at 80Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase Acetone 10 % v/v 100.0 86.1 % Digital Continuous Incubation: ?, Assay: Glycine-NaOH buffer Incubation: ?, Assay: 10 Incubation: 80Β°C, Assay: 60Β°C 0.007 Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control
1 2
Next β€Ί

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*