Lipase (gene Lac-Rh) from Lacticaseibacillus rhamnosus IDCC 3201
Enzyme Description
Extremophile
No
but "thermostable" enzyme
EC Number
Sequence
MLGDSLTYGVGDATNNGGFVGLTKGELEATGQYQVTTKNYGVSGNTSGQILTRVNKQPKIRADLKRANIITVTAGGNDLMHVLQKHFLTLSEKQVTAGSVAFQKRLATLLTTIRKENPTAPIYVFGIYNPFYVYFPKMTAMTNSVKAWNQATQKTLQQFDRTYYVDIDSVLSNGETAANKASAKEALKEATSGDGNPLIFSQDHFHPNNAGY
Mi Dan Kang et al. (2024)
β A lipase from Lacticaseibacillus rhamnosus IDCC 3201 with thermostability and pH resistance for use as a detergent additive
Applied Microbiology and Biotechnology
Β· doi:10.1007/s00253-024-13185-4 β
Β· Stability - Incubation
▼
Database ID
β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (20 measurements)
20 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Acetonitrile | 10 % v/v | 100.0 | 100.6 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 60Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Butyl Acetate | 30 % v/v | 100.0 | 0.0 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 60Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Butyl Acetate | 10 % v/v | 100.0 | 19.1 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 60Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | n-Hexane | 30 % v/v | 100.0 | 24.4 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 60Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | n-Hexane | 10 % v/v | 100.0 | 34.7 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 60Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Ethyl Acetate | 30 % v/v | 100.0 | 0.0 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 60Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Ethyl Acetate | 10 % v/v | 100.0 | 32.9 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 60Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Isopropanol | 30 % v/v | 100.0 | 61.5 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 60Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Isopropanol | 10 % v/v | 100.0 | 105.0 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 60Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Acetonitrile | 30 % v/v | 100.0 | 56.8 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 60Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Acetone | 10 % v/v | 100.0 | 109.4 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 60Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Ethanol | 30 % v/v | 100.0 | 75.3 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 60Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Ethanol | 10 % v/v | 100.0 | 93.5 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 60Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Methanol | 30 % v/v | 100.0 | 61.5 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 60Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Methanol | 10 % v/v | 100.0 | 107.6 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 60Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 30 % v/v | 100.0 | 97.6 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 60Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 10 % v/v | 100.0 | 126.8 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 60Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Glycerol | 30 % v/v | 100.0 | 81.8 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 60Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Glycerol | 10 % v/v | 100.0 | 137.0 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 60Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 60Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Acetone | 30 % v/v | 100.0 | 65.9 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM potassium phosphate buffer, 1 mg/ml gum arabic, 2% Triton X-100, 2 mg/ml sodium deoxycholate, ? % isopropanol | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 60Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Conflicting temperature legend main text, uncertainty about whether assay was really in aqueous phase |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.