Cutinase (gene MmCut3) from Mycobacterium marinum

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 267 amino acids
MNKHPLAVLAGALVTATGLLAAPSITGTAIPSASAADCPDAEVVFARGTSEPPGIGRVGEAFVDSLRQQTGKNIGVYAVNYPASRLQLHGGDGANDVISHVKSMASSCPNTKIVLGGYSQGADVIDIVAGVPLAGISFGNELPAQYADNIAAVAVFGNVANRSGGSLTTQSSLLGSKSIDLCNPSDPICHSGPGNDWNGHTDGYVPTYTTQAASFVAAKLAASSMAPVVQLPGPVPRAPGPAPQAPGPATASPGTPVGATGTLVGAH
Jayashree Ravi et al. (2025) β€” Enzymatic biodegradation of Poly(Ξ΅-Caprolactone) (PCL) by a thermostable cutinase from a mesophilic bacteria Mycobacterium marinum
Science of The Total Environment  Β· doi:10.1016/j.scitotenv.2025.179066 β†—  Β· Activity + Stability - Incubation
36 measurements
Database ID
UniProt: B2HCY2 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (36 measurements)

36 measurements β€” page 1 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent 1-Methoxyethanol 10 % v/v 100.0 0.0 % Direct Continuous Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethyl Acetate 40 % v/v 100.0 72.8 % Direct Continuous Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethyl Acetate 60 % v/v 100.0 70.2 % Direct Continuous Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Phenol 10 % v/v 100.0 35.8 % Direct Continuous Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Phenol 40 % v/v 100.0 5.6 % Direct Continuous Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Phenol 60 % v/v 100.0 0.0 % Direct Continuous Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Benzene 10 % v/v 100.0 45.5 % Direct Continuous Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Benzene 40 % v/v 100.0 12.5 % Direct Continuous Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Benzene 60 % v/v 100.0 0.0 % Direct Continuous Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethyl Acetate 10 % v/v 100.0 220.0 % Direct Continuous Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent 1-Methoxyethanol 40 % v/v 100.0 0.0 % Direct Continuous Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent 1-Methoxyethanol 60 % v/v 100.0 0.0 % Direct Continuous Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Hexylene Glycol 10 % v/v 100.0 59.2 % Direct Continuous Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Hexylene Glycol 40 % v/v 100.0 59.3 % Direct Continuous Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Hexylene Glycol 60 % v/v 100.0 10.5 % Direct Continuous Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Chloroform 10 % v/v 100.0 182.2 % Direct Continuous Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Chloroform 40 % v/v 100.0 150.0 % Direct Continuous Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Chloroform 60 % v/v 100.0 54.2 % Direct Continuous Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Isoamyl Alcohol 10 % v/v 100.0 21.4 % Direct Continuous Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 40 % v/v 100.0 12.7 % Direct Continuous Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
β€Ή Prev
1 2

Visualization : Activity + Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*