Ξ²-glucosidase (gene RpBgl8) from Reticulitermes perilucifugu
Enzyme Description
Sequence
MSALKFPPGFLFGSATSAYQVEGAWNEDGKSDSIWDRLTHDHPEIIKDKSSGDVACNSYHLYKEDVRILKELGVHFYRFSVSWTRILPTGYDNVVNQAGIDYYNNLINELIANGIQPMITMYHFDLPQPLQNLGGWTNPVIANYFEDYARVLYANFGDRVKWWNTINEPKTVALGYSAPFGLAPHVLTPGHGQYLVIHTILLSHARAYRLYEREFKDKQGGKVSIVASCQWIEPTTDSKEEEDAAERARQINLGWELHPIYSADGDYPPVMKQWISKKSKEEGYSRSRLPSFTKEEIELVRGTWDYLALNTYTTFFVRQSDEDSVFLSDTGVVSIPNDKYATASSEWLQVVPWGFRKLLNWIAKEYNNPPVLITENGFSDHGEINDTDRINFYITYLCELLKATKENGCNVIGYTAWSMMDNYEWRSGYTEKFGLFHVDFNDPDRKRTAKKSARVFSQIIKSNAIPVEFLAVETSH
Guotao Mao et al. (2025)
β Biochemical and Structural Characterization of a Highly Glucose-Tolerant Ξ²-Glucosidase from the Termite Reticulitermes perilucifugus
International Journal of Molecular Sciences
Β· doi:10.3390/ijms26073118 β
Β· Activity - Classical
▼
Database ID
UniProt: A0A7G5VX36 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (17 measurements)
17 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent | Isopropanol | 10 % v/v | 100 | 165 | % | Digital | Continuous | 20 mM phosphate buffer | 7 | 37Β°C | 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside | D-Glucose , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent | Ethanol | 20 % v/v | 100 | 55 | % | Digital | Continuous | 20 mM phosphate buffer | 7 | 37Β°C | 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside | D-Glucose , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent | Ethanol | 15 % v/v | 100 | 96 | % | Digital | Continuous | 20 mM phosphate buffer | 7 | 37Β°C | 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside | D-Glucose , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent | Ethanol | 10 % v/v | 100 | 180 | % | Digital | Continuous | 20 mM phosphate buffer | 7 | 37Β°C | 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside | D-Glucose , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent | Ethanol | 5 % v/v | 100 | 202 | % | Digital | Continuous | 20 mM phosphate buffer | 7 | 37Β°C | 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside | D-Glucose , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent | Ethanol | 2.5 % v/v | 100 | 183 | % | Digital | Continuous | 20 mM phosphate buffer | 7 | 37Β°C | 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside | D-Glucose , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent | Isopropanol | 25 % v/v | 100 | 31 | % | Digital | Continuous | 20 mM phosphate buffer | 7 | 37Β°C | 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside | D-Glucose , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent | Isopropanol | 20 % v/v | 100 | 51 | % | Digital | Continuous | 20 mM phosphate buffer | 7 | 37Β°C | 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside | D-Glucose , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent | Isopropanol | 15 % v/v | 100 | 75 | % | Digital | Continuous | 20 mM phosphate buffer | 7 | 37Β°C | 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside | D-Glucose , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent | Methanol | 2.5 % v/v | 100 | 232 | % | Digital | Continuous | 20 mM phosphate buffer | 7 | 37Β°C | 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside | D-Glucose , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent | Isopropanol | 5 % v/v | 100 | 168 | % | Digital | Continuous | 20 mM phosphate buffer | 7 | 37Β°C | 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside | D-Glucose , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent | Isopropanol | 2.5 % v/v | 100 | 192 | % | Digital | Continuous | 20 mM phosphate buffer | 7 | 37Β°C | 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside | D-Glucose , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent | Glycerol | 5 % v/v | 100 | 130 | % | Digital | Continuous | 20 mM phosphate buffer | 7 | 37Β°C | 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside | D-Glucose , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent | Glycerol | 2.5 % v/v | 100 | 172 | % | Digital | Continuous | 20 mM phosphate buffer | 7 | 37Β°C | 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside | D-Glucose , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent | 1-Butanol | 5 % v/v | 100 | 68 | % | Digital | Continuous | 20 mM phosphate buffer | 7 | 37Β°C | 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside | D-Glucose , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent | 1-Butanol | 2.5 % v/v | 100 | 160 | % | Digital | Continuous | 20 mM phosphate buffer | 7 | 37Β°C | 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside | D-Glucose , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 408 nm) in the presence of organic solvent | Methanol | 5 % v/v | 100 | 102 | % | Digital | Continuous | 20 mM phosphate buffer | 7 | 37Β°C | 5 mM p-Nitrophenyl Ξ²-D-glucopyranoside | D-Glucose , p-Nitrophenol | β | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.