4-oxalocrotonate tautomerase from Pseudomonas putida

Enzyme Description

Extremophile
No
EC Number
5.3.2.6 β†— (natural activity but non-natural Michaelis addition activity evaluated)

Sequence

Length: 62 amino acids
PIAQIHILEGRSDEQKETLIREVSEAISRSLDAPLTSVRVIITEMAKGHFGIGGELASKVRR
Chao Guo et al. (2020) β€” Tuning Enzyme Activity for Nonaqueous Solvents: Engineering an Enantioselective "Michaelase" for Catalysis in High Concentrations of Ethanol
ChemBioChem  Β· doi:10.1002/cbic.201900721 β†—  Β· Activity - Classical
1103 measurements
Database ID
UniProt: Q01468 β†—
Sequence Annotation
Explicit (first residue from UniProt sequence removed)
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (1103 measurements)

1103 measurements β€” page 55 of 56
Mutation Property Assay Solvent Solvent Volume Aqueous ReferenceWT Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
S30C Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 25 % v/v 100.0 119.0 198.0 % Digital Ordinal 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
S30C Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 40 % v/v 100.0 94.0 178.0 % Digital Ordinal 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
S30Y Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 15 % v/v 100.0 115.0 110.0 % Digital Ordinal 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
S30Y Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 25 % v/v 100.0 119.0 133.0 % Digital Ordinal 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
S30Y Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 40 % v/v 100.0 94.0 118.0 % Digital Ordinal 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
A33D Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 15 % v/v 100.0 115.0 126.0 % Digital Ordinal 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
A33D Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 25 % v/v 100.0 119.0 164.0 % Digital Ordinal 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
A33D Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 40 % v/v 100.0 94.0 188.0 % Digital Ordinal 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
S30C Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Isopropanol 15 % v/v 100.0 104.0 140.0 % Digital Ordinal 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
S30C Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Isopropanol 25 % v/v 100.0 76.0 132.0 % Digital Ordinal 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
S30C Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Isopropanol 40 % v/v 100.0 19.0 11.0 % Digital Ordinal 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
S30Y Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Isopropanol 15 % v/v 100.0 104.0 115.0 % Digital Ordinal 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
S30Y Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Isopropanol 25 % v/v 100.0 76.0 94.0 % Digital Ordinal 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
S30Y Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Isopropanol 40 % v/v 100.0 19.0 44.0 % Digital Ordinal 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
A33D Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Isopropanol 15 % v/v 100.0 104.0 123.0 % Digital Ordinal 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
A33D Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Isopropanol 25 % v/v 100.0 76.0 110.0 % Digital Ordinal 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
A33D Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent Isopropanol 40 % v/v 100.0 19.0 3.5 % Digital Ordinal 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
S30C Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent tert-Butanol 15 % v/v 100.0 119.0 68.0 % Digital Ordinal 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
S30C Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent tert-Butanol 25 % v/v 100.0 78.0 52.0 % Digital Ordinal 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
S30Y Activity - Classical Activity of cell free extracts measured by absorbance spectrophotometry (decrease in Ξ²-Nitrostyrene absorbance measurement, 320 nm) in the presence of organic solvent tert-Butanol 15 % v/v 100.0 119.0 103.0 % Digital Ordinal 20 mM sodium phosphate buffer 7.3 Room temperature 50 mM Acetaldehyde, 2 mM Ξ²-Nitrostyrene (R)-4-Nitro-3-phenylButyraldehyde β€” β€” Classical aqueous control (in %) in 5% organic solvent | Deducted temperature
1 … 53 54 55 56
Mutations in this dataset (1036)

Visualization : Activity β€” Classical

Mutation Effect

Select a condition below. Conditions with >50 mutations show a heatmap, ranked lollipop, or ranked lollipop; others show paired bars per mutation.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*