Uncharacterized hydrolase (gene dehpH) from Mycolicibacterium phocaicum RL-HY01
Enzyme Description
Extremophile
No
but"cold-adapted" enzyme
EC Number
Sequence
MTMSMPGDAVRAAATTDAELVVRPEHPTAGRPSRLRLATLTRIGGTALRILPKIPDRLKRVLLRGRRVTIDGNTLDTTLLMLTAQNASGAGGLVASSDVTVARAEIARLSQGLDPGIAVATTDFTIPGPTEQLRARHYQPDGTGPAPMLVFFHGGGFVVGGCIESHDGLCRLISRDAGVHVVSVEYRLAPEHPAPAASDDCYATYLWCVENAARLGADPAKIAVGGDSAGGNLAAVVSQLARDNHKPLPALQLLIYPVTNFAGDTRSKVLFADGYFLSKIDMDWFRANYLAESALDPSDPRVSPLLAEDLSGLPPALVLTGGFDPLRDEGDAYAAALAAAGVPVDHRRYGSLIHAFANFFPLGGDSAVATADFISAFRAHLTR
Lei Ren et al. (2025)
β Identification and Characterization of a Novel Di-(2-ethylhexyl) Phthalate Hydrolase from a Marine Bacterial Strain Mycolicibacterium phocaicum RL-HY01
International Journal of Molecular Sciences
Β· doi:10.3390/ijms26178141 β
Β· Activity - Classical
▼
Database ID
UniParc: UPI000928E919 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (7 measurements)
7 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by gas chromatography (substrate DEHP concentration measurement) | Methanol | 1 % v/v | 100.0 | 92.3 | % | Digital | Continuous | 50 mM Tris-HCl buffer | 8 | 30Β°C | 200 Β΅M Di(2-ethylhexyl) phthalate | 2-Ethylhexanol , Mono-(2-ethylhexyl) phthalate (MEHP) | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by gas chromatography (substrate DEHP concentration measurement) | Ethanol | 1 % v/v | 100.0 | 94.9 | % | Digital | Continuous | 50 mM Tris-HCl buffer | 8 | 30Β°C | 200 Β΅M Di(2-ethylhexyl) phthalate | 2-Ethylhexanol , Mono-(2-ethylhexyl) phthalate (MEHP) | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by gas chromatography (substrate DEHP concentration measurement) | Isopropanol | 1 % v/v | 100.0 | 89.2 | % | Digital | Continuous | 50 mM Tris-HCl buffer | 8 | 30Β°C | 200 Β΅M Di(2-ethylhexyl) phthalate | 2-Ethylhexanol , Mono-(2-ethylhexyl) phthalate (MEHP) | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by gas chromatography (substrate DEHP concentration measurement) | Acetone | 1 % v/v | 100.0 | 88.5 | % | Digital | Continuous | 50 mM Tris-HCl buffer | 8 | 30Β°C | 200 Β΅M Di(2-ethylhexyl) phthalate | 2-Ethylhexanol , Mono-(2-ethylhexyl) phthalate (MEHP) | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by gas chromatography (substrate DEHP concentration measurement) | Acetonitrile | 1 % v/v | 100.0 | 89.6 | % | Digital | Continuous | 50 mM Tris-HCl buffer | 8 | 30Β°C | 200 Β΅M Di(2-ethylhexyl) phthalate | 2-Ethylhexanol , Mono-(2-ethylhexyl) phthalate (MEHP) | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by gas chromatography (substrate DEHP concentration measurement) | Ethyl Acetate | 1 % v/v | 100.0 | 99.1 | % | Digital | Continuous | 50 mM Tris-HCl buffer | 8 | 30Β°C | 200 Β΅M Di(2-ethylhexyl) phthalate | 2-Ethylhexanol , Mono-(2-ethylhexyl) phthalate (MEHP) | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by gas chromatography (substrate DEHP concentration measurement) | n-Hexane | 1 % v/v | 100.0 | 97.8 | % | Digital | Continuous | 50 mM Tris-HCl buffer | 8 | 30Β°C | 200 Β΅M Di(2-ethylhexyl) phthalate | 2-Ethylhexanol , Mono-(2-ethylhexyl) phthalate (MEHP) | β | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.