D-2-hydroxyacid dehydrogenase (gene D2HDH) from Haloferax mediterranei
Enzyme Description
Sequence
MHIERLAVDESVGRAMPPQRFIEALSDLGVPVEFAGEDEQFGPGDAVASFGHRDAFLDADWVHCIRAGYDEFPVGVYEEAGTYLTNSTGIHGTTVGETVAGYMLTFARRLHAYRDAQHDHAWDLPRYEEPFTLAGERVCVVGLGTLGRGVVDRAAALGMEVVGVRRSGDPVDNVSTVYTPDRLHEAIADARFVVLATPLTDETEGMVAAPEFETMREDASLVNVARGPVVVESDLVAALDSGDIAGAALDVFSEEPLPEDSPLWDFEDVLITPHVSAATSKYHEDVAALIRENIEKIATGDELTNRVV
Jessica Domenech et al. (2025)
β Potassium binding by carbonyl clusters, halophilic adaptation and catalysis of Haloferax mediterranei D-2-hydroxyacid dehydrogenase
Communications Biology
Β· doi:10.1038/s42003-025-08587-7 β
Β· Activity - Classical
▼
Database ID
PDB: 9IBE β
Sequence Annotation
Explicit - Provided PDB Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli
Experimental Data (24 measurements)
24 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent | Glycerol | 20 % v/v | 2.21 | 1.39 | U/mg | Digital | Continuous | 50 mM Tris-HCl buffer, 2M NaCl | 8 | 40Β°C | 6.5 mM 2-Oxohexanoic acid | D-2-hydroxyhexanoic acid | 0.3 mM NADH | β | Classical aqueous control (in U/mg) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 20 % v/v | 2.31 | 0.7 | U/mg | Digital | Continuous | 50 mM Tris-HCl buffer, 2M NaCl | 8 | 40Β°C | 12.5 mM 2-Oxohexanoic acid | D-2-hydroxyhexanoic acid | 0.3 mM NADH | β | Classical aqueous control (in U/mg) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 20 % v/v | 2.28 | 0.69 | U/mg | Digital | Continuous | 50 mM Tris-HCl buffer, 2M NaCl | 8 | 40Β°C | 10 mM 2-Oxohexanoic acid | D-2-hydroxyhexanoic acid | 0.3 mM NADH | β | Classical aqueous control (in U/mg) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 20 % v/v | 2.25 | 0.68 | U/mg | Digital | Continuous | 50 mM Tris-HCl buffer, 2M NaCl | 8 | 40Β°C | 8 mM 2-Oxohexanoic acid | D-2-hydroxyhexanoic acid | 0.3 mM NADH | β | Classical aqueous control (in U/mg) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 20 % v/v | 2.21 | 0.67 | U/mg | Digital | Continuous | 50 mM Tris-HCl buffer, 2M NaCl | 8 | 40Β°C | 6.5 mM 2-Oxohexanoic acid | D-2-hydroxyhexanoic acid | 0.3 mM NADH | β | Classical aqueous control (in U/mg) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 20 % v/v | 2.15 | 0.65 | U/mg | Digital | Continuous | 50 mM Tris-HCl buffer, 2M NaCl | 8 | 40Β°C | 5 mM 2-Oxohexanoic acid | D-2-hydroxyhexanoic acid | 0.3 mM NADH | β | Classical aqueous control (in U/mg) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 20 % v/v | 2.08 | 0.63 | U/mg | Digital | Continuous | 50 mM Tris-HCl buffer, 2M NaCl | 8 | 40Β°C | 4 mM 2-Oxohexanoic acid | D-2-hydroxyhexanoic acid | 0.3 mM NADH | β | Classical aqueous control (in U/mg) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 20 % v/v | 1.83 | 0.55 | U/mg | Digital | Continuous | 50 mM Tris-HCl buffer, 2M NaCl | 8 | 40Β°C | 2 mM 2-Oxohexanoic acid | D-2-hydroxyhexanoic acid | 0.3 mM NADH | β | Classical aqueous control (in U/mg) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 20 % v/v | 1.46 | 0.44 | U/mg | Digital | Continuous | 50 mM Tris-HCl buffer, 2M NaCl | 8 | 40Β°C | 1 mM 2-Oxohexanoic acid | D-2-hydroxyhexanoic acid | 0.3 mM NADH | β | Classical aqueous control (in U/mg) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent | Glycerol | 20 % v/v | 2.31 | 1.48 | U/mg | Digital | Continuous | 50 mM Tris-HCl buffer, 2M NaCl | 8 | 40Β°C | 12.5 mM 2-Oxohexanoic acid | D-2-hydroxyhexanoic acid | 0.3 mM NADH | β | Classical aqueous control (in U/mg) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent | Glycerol | 20 % v/v | 2.28 | 1.46 | U/mg | Digital | Continuous | 50 mM Tris-HCl buffer, 2M NaCl | 8 | 40Β°C | 10 mM 2-Oxohexanoic acid | D-2-hydroxyhexanoic acid | 0.3 mM NADH | β | Classical aqueous control (in U/mg) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent | Glycerol | 20 % v/v | 2.25 | 1.43 | U/mg | Digital | Continuous | 50 mM Tris-HCl buffer, 2M NaCl | 8 | 40Β°C | 8 mM 2-Oxohexanoic acid | D-2-hydroxyhexanoic acid | 0.3 mM NADH | β | Classical aqueous control (in U/mg) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent | Ethanol | 20 % v/v | 1.46 | 1.23 | U/mg | Digital | Continuous | 50 mM Tris-HCl buffer, 2M NaCl | 8 | 40Β°C | 1 mM 2-Oxohexanoic acid | D-2-hydroxyhexanoic acid | 0.3 mM NADH | β | Classical aqueous control (in U/mg) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent | Glycerol | 20 % v/v | 2.15 | 1.33 | U/mg | Digital | Continuous | 50 mM Tris-HCl buffer, 2M NaCl | 8 | 40Β°C | 5 mM 2-Oxohexanoic acid | D-2-hydroxyhexanoic acid | 0.3 mM NADH | β | Classical aqueous control (in U/mg) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent | Glycerol | 20 % v/v | 2.08 | 1.27 | U/mg | Digital | Continuous | 50 mM Tris-HCl buffer, 2M NaCl | 8 | 40Β°C | 4 mM 2-Oxohexanoic acid | D-2-hydroxyhexanoic acid | 0.3 mM NADH | β | Classical aqueous control (in U/mg) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent | Glycerol | 20 % v/v | 1.83 | 1.05 | U/mg | Digital | Continuous | 50 mM Tris-HCl buffer, 2M NaCl | 8 | 40Β°C | 2 mM 2-Oxohexanoic acid | D-2-hydroxyhexanoic acid | 0.3 mM NADH | β | Classical aqueous control (in U/mg) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent | Glycerol | 20 % v/v | 1.46 | 0.78 | U/mg | Digital | Continuous | 50 mM Tris-HCl buffer, 2M NaCl | 8 | 40Β°C | 1 mM 2-Oxohexanoic acid | D-2-hydroxyhexanoic acid | 0.3 mM NADH | β | Classical aqueous control (in U/mg) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent | Ethanol | 20 % v/v | 2.31 | 2.02 | U/mg | Digital | Continuous | 50 mM Tris-HCl buffer, 2M NaCl | 8 | 40Β°C | 12.5 mM 2-Oxohexanoic acid | D-2-hydroxyhexanoic acid | 0.3 mM NADH | β | Classical aqueous control (in U/mg) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent | Ethanol | 20 % v/v | 2.28 | 1.99 | U/mg | Digital | Continuous | 50 mM Tris-HCl buffer, 2M NaCl | 8 | 40Β°C | 10 mM 2-Oxohexanoic acid | D-2-hydroxyhexanoic acid | 0.3 mM NADH | β | Classical aqueous control (in U/mg) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent | Ethanol | 20 % v/v | 2.25 | 1.96 | U/mg | Digital | Continuous | 50 mM Tris-HCl buffer, 2M NaCl | 8 | 40Β°C | 8 mM 2-Oxohexanoic acid | D-2-hydroxyhexanoic acid | 0.3 mM NADH | β | Classical aqueous control (in U/mg) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.