Esterase (gene EstEk04) from Epidermidibacterium keratini EPI-7
Enzyme Description
Sequence
MRMRTPFAATGAALATLLLASPAAAAPDGLDAGQPASQQVATAAAAAPVQVVVQLGDSYSSGNGARDEAGNPAYSADAPSCLRSPFNYGQQFATSIEAQYINAACSGAVFADIRTPKASAGVPAQIDAVTEQTDVVLMTMGGNDIGFGQIVVQCFALRSGDGCRSAIEQAQAAIPQLEETAYTEISAIRAKMRPDAAFIYVGYPGLTSAEEVLPTTDGQGYDMVAGLTELQAAGEDAQAAAVARVNADSPCGARTFYLDTVDEAFAGHEIDQSQPGIDPATWFWNFGETLTIGEIYHPKPAGWNAEAQLVSALYAEQVQTTPTLSVDPTSVLQGGEVTLTADGFRSGETVRVVLAPDIDQVVTVDQCGTFTGTITLSPETATGERTVTATSEATGASASASFTVTAAPTTPPPTTEPTAPPTTTEPTAPTAPPTTSESPSTTVAPIAGGSGGKSGSGGGQLPRTGAGGVDELGWVAIALLASGGALLAAGRRRVS
Seok-Yun Jeong et al. (2025)
β Cloning, Expression, and Characterization of GDSL-Type Lipolytic Enzyme Genes from Epidermidibacterium keratini EPI-7 Isolated from Human Skin
Journal of Microbiology and Biotechnology
Β· doi:10.4014/jmb.2504.04022 β
Β· Stability - Incubation
▼
Database ID
UniProt: A0A7L4YM98 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21
Experimental Data (6 measurements)
6 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Methanol | 15 % v/v | 100 | 84 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 10% isopropanol, 0.4% Triton X-100, 0.1% gum arabic | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 40Β°C | 1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Ethanol | 15 % v/v | 100 | 84 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 10% isopropanol, 0.4% Triton X-100, 0.1% gum arabic | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 40Β°C | 1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Isopropanol | 15 % v/v | 100 | 85 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 10% isopropanol, 0.4% Triton X-100, 0.1% gum arabic | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 40Β°C | 1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Acetone | 15 % v/v | 100 | 83 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 10% isopropanol, 0.4% Triton X-100, 0.1% gum arabic | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 40Β°C | 1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Acetonitrile | 15 % v/v | 100 | 67 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 10% isopropanol, 0.4% Triton X-100, 0.1% gum arabic | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 40Β°C | 1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 15 % v/v | 100 | 81 | % | Direct | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 10% isopropanol, 0.4% Triton X-100, 0.1% gum arabic | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 40Β°C | 1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.