Esterase (gene EstEk04) from Epidermidibacterium keratini EPI-7

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 495 amino acids
MRMRTPFAATGAALATLLLASPAAAAPDGLDAGQPASQQVATAAAAAPVQVVVQLGDSYSSGNGARDEAGNPAYSADAPSCLRSPFNYGQQFATSIEAQYINAACSGAVFADIRTPKASAGVPAQIDAVTEQTDVVLMTMGGNDIGFGQIVVQCFALRSGDGCRSAIEQAQAAIPQLEETAYTEISAIRAKMRPDAAFIYVGYPGLTSAEEVLPTTDGQGYDMVAGLTELQAAGEDAQAAAVARVNADSPCGARTFYLDTVDEAFAGHEIDQSQPGIDPATWFWNFGETLTIGEIYHPKPAGWNAEAQLVSALYAEQVQTTPTLSVDPTSVLQGGEVTLTADGFRSGETVRVVLAPDIDQVVTVDQCGTFTGTITLSPETATGERTVTATSEATGASASASFTVTAAPTTPPPTTEPTAPPTTTEPTAPTAPPTTSESPSTTVAPIAGGSGGKSGSGGGQLPRTGAGGVDELGWVAIALLASGGALLAAGRRRVS
Seok-Yun Jeong et al. (2025) β€” Cloning, Expression, and Characterization of GDSL-Type Lipolytic Enzyme Genes from Epidermidibacterium keratini EPI-7 Isolated from Human Skin
Journal of Microbiology and Biotechnology  Β· doi:10.4014/jmb.2504.04022 β†—  Β· Stability - Incubation
6 measurements
Database ID
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21

Experimental Data (6 measurements)

6 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Methanol 15 % v/v 100 84 % Direct Continuous Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 10% isopropanol, 0.4% Triton X-100, 0.1% gum arabic Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 40Β°C 1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Ethanol 15 % v/v 100 84 % Direct Continuous Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 10% isopropanol, 0.4% Triton X-100, 0.1% gum arabic Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 40Β°C 1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Isopropanol 15 % v/v 100 85 % Direct Continuous Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 10% isopropanol, 0.4% Triton X-100, 0.1% gum arabic Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 40Β°C 1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Acetone 15 % v/v 100 83 % Direct Continuous Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 10% isopropanol, 0.4% Triton X-100, 0.1% gum arabic Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 40Β°C 1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Acetonitrile 15 % v/v 100 67 % Direct Continuous Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 10% isopropanol, 0.4% Triton X-100, 0.1% gum arabic Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 40Β°C 1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase
Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 15 % v/v 100 81 % Direct Continuous Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 10% isopropanol, 0.4% Triton X-100, 0.1% gum arabic Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 40Β°C 1 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay really was in aqueous phase

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*